PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID GSMUA_Achr4P19750_001
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Zingiberales; Musaceae; Musa
Family GRAS
Protein Properties Length: 862aa    MW: 96583.6 Da    PI: 5.8687
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
GSMUA_Achr4P19750_001genomeCIRADView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS412.83e-1262195852373
                   GRAS   2 velLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlarsvselykalppsetseknsseelaalklfsevsP 89 
                             +lL++cAe +ssg+ e  + +Larl e+a+p g+p++R++ay+teALa r+++  ++++++ pp++  + ++++ + al+l++ v+P
  GSMUA_Achr4P19750_001 219 LSLLTSCAESISSGNYEGMTFFLARLGETATPLGTPLHRVVAYYTEALALRVVKLRPHIFSIAPPKTLVHPTEDDDAVALRLLNCVTP 306
                            689******************************************************************999**************** PP

                   GRAS  90 ilkfshltaNqaIleavegeervHiiDfdisqGlQWpaLlqaLasRpegppslRiTgvgspesgskeeleetgerLakfAeelgvpfe 177
                            +lkf h+t N+ +l+a+eg +rvHiiD+di+qGlQWp+Llq+LasRp++p +lRiTgvg+    s++ l+ tg  La++Ae+l++pfe
  GSMUA_Achr4P19750_001 307 VLKFLHFTMNERLLKAFEGRDRVHIIDLDIKQGLQWPSLLQSLASRPSPPSHLRITGVGE----SRQDLQDTGAALARLAESLNLPFE 390
                            ************************************************************....9*********************** PP

                   GRAS 178 fnvlvakrledleleeLrvkpgEalaVnlvlqlhrlldesvsleserdevLklvkslsPkvvvvveqeadhnsesFlerflealeyys 265
                            f++ va+rled++l++L+vk++E++aVn+vl +h+ l++  ++ ++  ++L l++s++P++vv++eqea+hn++++ +rf+++l+yy+
  GSMUA_Achr4P19750_001 391 FHA-VADRLEDVRLWMLHVKREECVAVNCVLTMHKALSD--ESGKAFMDLLGLIRSTRPEIVVMAEQEAKHNEPNWETRFSRSLSYYA 475
                            ***.8*******************************943..44444689*************************************** PP

                   GRAS 266 alfdsleaklpreseerikvErellgreivnvvacegaerrerhetlekWrerleeaGFkpvplsekaakqaklllrkvksdgyrve. 352
                            a+fds++  lpr+s +rikvE++ ++rei+n+vaceg er+erhe++ +Wr+ +e+ GFk + ++e+++ q +++lr+++ d y ++ 
  GSMUA_Achr4P19750_001 476 AIFDSMDYALPRDSPARIKVEQV-FAREIRNAVACEGGERTERHENFDRWRKLMEDGGFKCLGIGEREMLQSRMILRMYSCDKYAIDn 562
                            **********************9.********************************************************999***97 PP

                   GRAS 353 ..eesgslvlgWkdrpLvsvSaW 373
                              ee + l+l W+d+pL++vSaW
  GSMUA_Achr4P19750_001 563 qgEEGDGLTLRWSDQPLYTVSAW 585
                            777799999************** PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098558.194192563IPR005202Transcription factor GRAS
PfamPF035141.0E-123219585IPR005202Transcription factor GRAS
PfamPF128615.0E-5807857IPR024991Anaphase-promoting complex subunit 11
Gene3DG3DSA:3.30.40.109.6E-8816857IPR013083Zinc finger, RING/FYVE/PHD-type
SuperFamilySSF578504.18E-10819857No hitNo description
CDDcd001627.30E-9819857No hitNo description
PROSITE profilePS500899.258820857IPR001841Zinc finger, RING-type
SMARTSM001840.0043820860IPR001841Zinc finger, RING-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005680Cellular Componentanaphase-promoting complex
GO:0004842Molecular Functionubiquitin-protein transferase activity
GO:0005515Molecular Functionprotein binding
GO:0008270Molecular Functionzinc ion binding
Sequence ? help Back to Top
Protein Sequence    Length: 862 aa     Download sequence    Send to blast
MLAGCSSTLL SPRHKLRIDA SVQLQSCHFQ LQDKHCHPQQ KMGTQRLDLP CGFSSRKDPL  60
RMALSVEKPP PAEARRSSCS FRRNPVTTSS MAAQTPSWGG IDEGHGRPWD RRRSLKRFHE  120
RGSCDDDRAK RTRTGGGVSG LVEVDGEVWF PRSTQEPPPV EEDKVFLVPN AASFPLPAST  180
SHALSDSSTS STAYASSPEP TKDSSGNGSS AEQQGLELLS LLTSCAESIS SGNYEGMTFF  240
LARLGETATP LGTPLHRVVA YYTEALALRV VKLRPHIFSI APPKTLVHPT EDDDAVALRL  300
LNCVTPVLKF LHFTMNERLL KAFEGRDRVH IIDLDIKQGL QWPSLLQSLA SRPSPPSHLR  360
ITGVGESRQD LQDTGAALAR LAESLNLPFE FHAVADRLED VRLWMLHVKR EECVAVNCVL  420
TMHKALSDES GKAFMDLLGL IRSTRPEIVV MAEQEAKHNE PNWETRFSRS LSYYAAIFDS  480
MDYALPRDSP ARIKVEQVFA REIRNAVACE GGERTERHEN FDRWRKLMED GGFKCLGIGE  540
REMLQSRMIL RMYSCDKYAI DNQGEEGDGL TLRWSDQPLY TVSAWAPTDV AGGSSTKRAE  600
RLTREEDPSD KNRGGPLIKV AIMTMEHQIV EKQDVTIHRL HTTVPNVSEE ISEEFLLDFD  660
DLAVQEIVYQ SFQKNPHEHQ CHASVNESRS NHEIGQSSHG GSSSVTTDIL LQFTSDEAIA  720
QQYEILDNLP ADASFSALNQ SEAAENISDQ MSGGSSSADS PGQDTRQDSI DPDQMSYEQL  780
QSLEEEMGNE SRGLSDELIS YLRDLKHKCG FFSKGKNEEC VICKMNYRRE WLITLPCKHC  840
YHSHCIIRWL EDNKVRCYMT LL
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5hyz_A4e-4624158526374GRAS family transcription factor containing p
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor involved in plant development. {ECO:0000250}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009398727.10.0PREDICTED: scarecrow-like protein 28
SwissprotQ9CAN31e-160SCL28_ARATH; Scarecrow-like protein 28
TrEMBLM0SQD80.0M0SQD8_MUSAM; Uncharacterized protein
STRINGGSMUA_Achr4P19750_0010.0(Musa acuminata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP64043455
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G63100.11e-159GRAS family protein