PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID GSMUA_Achr4P03670_001
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Zingiberales; Musaceae; Musa
Family RAV
Protein Properties Length: 294aa    MW: 32833.8 Da    PI: 8.8528
Description RAV family protein
Gene Model
Gene Model ID Type Source Coding Sequence
GSMUA_Achr4P03670_001genomeCIRADView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1AP240.28.4e-135199155
                    AP2  1 sgykGVrwdkkrgrWvAeIrdpsengkrkrfslgkfgtaeeAakaaiaarkkleg 55
                           s+ykGV   + +grW A+I++      ++r++lg+f  + +Aa+a++ a ++++g
  GSMUA_Achr4P03670_001 51 SKYKGVVSQP-NGRWGAQIYEK-----HQRIWLGTFNEEAQAARAYDVAVQRFRG 99
                           89****8888.8*********3.....5**********99************998 PP

2B3681.3e-211612282794
                            ---..--SEEEEEETTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE-SSSEE..EE CS
                     B3  27 ggkkeesktltledesgrsWevkliyrkksgryvltkGWkeFvkangLkegDfvvFkldgrsefelvv 94 
                            gg   +++ l++ed  g++W+++++y+++s +yvlt+GW++Fvk+++L++gD+v+F+++  ++++l++
  GSMUA_Achr4P03670_001 161 GGAASKGVLLSFEDGCGKEWRFRYSYWNSSHSYVLTRGWSRFVKEKRLEAGDVVTFQRSTGTDKQLFI 228
                            556678899************************************************87556665655 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
CDDcd000183.29E-2251106No hitNo description
PfamPF008475.5E-85199IPR001471AP2/ERF domain
SuperFamilySSF541711.11E-1651107IPR016177DNA-binding domain
Gene3DG3DSA:3.30.730.102.3E-2052107IPR001471AP2/ERF domain
SMARTSM003808.5E-2752113IPR001471AP2/ERF domain
PROSITE profilePS5103219.7352107IPR001471AP2/ERF domain
SMARTSM010191.7E-4105234IPR003340B3 DNA binding domain
PfamPF023622.9E-19160229IPR003340B3 DNA binding domain
Gene3DG3DSA:2.40.330.102.8E-23163234IPR015300DNA-binding pseudobarrel domain
CDDcd100172.53E-16165219No hitNo description
SuperFamilySSF1019361.31E-18165229IPR015300DNA-binding pseudobarrel domain
PROSITE profilePS5086311.815170234IPR003340B3 DNA binding domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 294 aa     Download sequence    Send to blast
MATSSIEEAC EETREWPPVA SKSLQRVASG GSEVIDPEGC VEAEFRKLPS SKYKGVVSQP  60
NGRWGAQIYE KHQRIWLGTF NEEAQAARAY DVAVQRFRGR DAVTNFKPLN DADDEDAAEL  120
FFLDSHTKHE IVDMLRKRTY HNELQQSKRS IGADNKKGIA GGAASKGVLL SFEDGCGKEW  180
RFRYSYWNSS HSYVLTRGWS RFVKEKRLEA GDVVTFQRST GTDKQLFIDA KARSGVQVLR  240
LFGVNIVRGP AAAIGEGGVD DNAVFCTTGK KNRDHITELV SSQGMFKKQR TEAL
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1wid_A3e-3016623550119DNA-binding protein RAV1
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtBinds specifically to bipartite recognition sequences composed of two unrelated motifs, 5'-CAACA-3' and 5'-CACCTG-3'. May function as negative regulator of plant growth and development. {ECO:0000269|PubMed:15040885, ECO:0000269|PubMed:9862967}.
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: Down-regulated by brassinosteroid and zeatin. {ECO:0000269|PubMed:15040885}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009394714.10.0PREDICTED: AP2/ERF and B3 domain-containing transcription factor RAV1-like
SwissprotQ9ZWM93e-93RAV1_ARATH; AP2/ERF and B3 domain-containing transcription factor RAV1
TrEMBLM0SKT40.0M0SKT4_MUSAM; Uncharacterized protein
STRINGGSMUA_Achr4P03670_0010.0(Musa acuminata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP45638203
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G68840.23e-82related to ABI3/VP1 2
Publications ? help Back to Top
  1. Matías-Hernández L,Aguilar-Jaramillo AE,Marín-González E,Suárez-López P,Pelaz S
    RAV genes: regulation of floral induction and beyond.
    Ann. Bot., 2014. 114(7): p. 1459-70
    [PMID:24812253]
  2. Mittal A,Jiang Y,Ritchie GL,Burke JJ,Rock CD
    AtRAV1 and AtRAV2 overexpression in cotton increases fiber length differentially under drought stress and delays flowering.
    Plant Sci., 2015. 241: p. 78-95
    [PMID:26706061]
  3. Huang Y,Feng CZ,Ye Q,Wu WH,Chen YF
    Arabidopsis WRKY6 Transcription Factor Acts as a Positive Regulator of Abscisic Acid Signaling during Seed Germination and Early Seedling Development.
    PLoS Genet., 2016. 12(2): p. e1005833
    [PMID:26829043]
  4. Zhao Y, et al.
    ABA receptor PYL9 promotes drought resistance and leaf senescence.
    Proc. Natl. Acad. Sci. U.S.A., 2016. 113(7): p. 1949-54
    [PMID:26831097]