PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID GSMUA_Achr3P29380_001
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Zingiberales; Musaceae; Musa
Family RAV
Protein Properties Length: 263aa    MW: 28717.6 Da    PI: 10.217
Description RAV family protein
Gene Model
Gene Model ID Type Source Coding Sequence
GSMUA_Achr3P29380_001genomeCIRADView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1AP237.55.8e-1252100155
                    AP2   1 sgykGVrwdkkrgrWvAeIrdpsengkrkrfslgkfgtaeeAakaaiaarkkleg 55 
                            s+ykGV   + +grW A+I++      ++r++lg+f  + eAa+a++ a ++++g
  GSMUA_Achr3P29380_001  52 SQYKGVVPQP-NGRWGAQIYEK-----HQRVWLGTFNREAEAARAYDVAVQRFRG 100
                            78****9888.8*********3.....5**********99************998 PP

2B336.31e-111722045890
                            EEEE-TTHHHHHHHHT--TT-EEEEEE-SSSEE CS
                     B3  58 ryvltkGWkeFvkangLkegDfvvFkldgrsef 90 
                            +yvltkGW++Fvk++gL +gD+v+F+++   ++
  GSMUA_Achr3P29380_001 172 SYVLTKGWSRFVKEKGLGAGDVVTFQRSTGPGK 204
                            69************************7644444 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF541718.5E-1652108IPR016177DNA-binding domain
CDDcd000181.04E-2152108No hitNo description
SMARTSM003801.5E-2453114IPR001471AP2/ERF domain
PfamPF008472.0E-753100IPR001471AP2/ERF domain
Gene3DG3DSA:3.30.730.105.1E-1953107IPR001471AP2/ERF domain
PROSITE profilePS5103218.91353108IPR001471AP2/ERF domain
Gene3DG3DSA:2.40.330.107.3E-11139171IPR015300DNA-binding pseudobarrel domain
SuperFamilySSF1019367.06E-18141207IPR015300DNA-binding pseudobarrel domain
CDDcd100171.46E-18142218No hitNo description
SMARTSM010191.1E-4144212IPR003340B3 DNA binding domain
Gene3DG3DSA:2.40.330.108.7E-11172212IPR015300DNA-binding pseudobarrel domain
PfamPF023629.8E-9172201IPR003340B3 DNA binding domain
PROSITE profilePS508638.656172213IPR003340B3 DNA binding domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 263 aa     Download sequence    Send to blast
MNSAQVACGE IGKRASPLVA GAKSLQRVGS GGSDVIDPEV GVEAESRKLP PSQYKGVVPQ  60
PNGRWGAQIY EKHQRVWLGT FNREAEAARA YDVAVQRFRG RDAITNLRPL NDADNNDDAA  120
ELFFLGSHSK AEISPIGTQR QHLFDKAMTP SDVGKLNRLV IPKHHAEKHF PSYVLTKGWS  180
RFVKEKGLGA GDVVTFQRST GPGKQLFIDS KSPVQIFRLF GVNIVRTPAA GSAACCGTGK  240
RTRDRMELAS SQEMVKKQCT ESL
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1wid_A5e-2714321213116DNA-binding protein RAV1
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtProbably acts as a transcriptional activator. Binds to the GCC-box pathogenesis-related promoter element. May be involved in the regulation of gene expression by stress factors and by components of stress signal transduction pathways (By similarity). Transcriptional repressor of flowering time on long day plants. Acts directly on FT expression by binding 5'-CAACA-3' and 5'-CACCTG-3 sequences (Probable). Functionally redundant with TEM1. {ECO:0000250, ECO:0000269|PubMed:18718758, ECO:0000305}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankBT0419626e-47BT041962.2 Zea mays full-length cDNA clone ZM_BFb0089O18 mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_018679470.11e-174PREDICTED: AP2/ERF and B3 domain-containing protein Os05g0549800-like
SwissprotP822806e-83RAV2_ARATH; AP2/ERF and B3 domain-containing transcription repressor RAV2
TrEMBLM0SIV40.0M0SIV4_MUSAM; Uncharacterized protein
STRINGGSMUA_Achr3P29380_0010.0(Musa acuminata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP45638203
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G68840.21e-84related to ABI3/VP1 2
Publications ? help Back to Top
  1. Matías-Hernández L,Aguilar-Jaramillo AE,Marín-González E,Suárez-López P,Pelaz S
    RAV genes: regulation of floral induction and beyond.
    Ann. Bot., 2014. 114(7): p. 1459-70
    [PMID:24812253]
  2. Marín-González E, et al.
    SHORT VEGETATIVE PHASE Up-Regulates TEMPRANILLO2 Floral Repressor at Low Ambient Temperatures.
    Plant Physiol., 2015. 169(2): p. 1214-24
    [PMID:26243615]
  3. Sun YW, et al.
    Attenuation of Histone Methyltransferase KRYPTONITE-mediated transcriptional gene silencing by Geminivirus.
    Sci Rep, 2015. 5: p. 16476
    [PMID:26602265]
  4. Mittal A,Jiang Y,Ritchie GL,Burke JJ,Rock CD
    AtRAV1 and AtRAV2 overexpression in cotton increases fiber length differentially under drought stress and delays flowering.
    Plant Sci., 2015. 241: p. 78-95
    [PMID:26706061]
  5. Matías-Hernández L, et al.
    TEMPRANILLO Reveals the Mesophyll as Crucial for Epidermal Trichome Formation.
    Plant Physiol., 2016. 170(3): p. 1624-39
    [PMID:26802039]
  6. Li P, et al.
    The Arabidopsis UGT87A2, a stress-inducible family 1 glycosyltransferase, is involved in the plant adaptation to abiotic stresses.
    Physiol Plant, 2017. 159(4): p. 416-432
    [PMID:27747895]