PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID GSMUA_Achr3P24170_001
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Zingiberales; Musaceae; Musa
Family M-type_MADS
Protein Properties Length: 357aa    MW: 40358.3 Da    PI: 6.9306
Description M-type_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
GSMUA_Achr3P24170_001genomeCIRADView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF69.72.8e-22953145
                           S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSE CS
                 SRF-TF  1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgk 45
                           kr en+s rqvt+skR++gilKKA+ELS+LCd++  +++f+++gk
  GSMUA_Achr3P24170_001  9 KRLENSSSRQVTYSKRKAGILKKAKELSILCDIDLVLLMFAPNGK 53
                           789****************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5006624.53153IPR002100Transcription factor, MADS-box
SMARTSM004321.1E-29160IPR002100Transcription factor, MADS-box
CDDcd002666.69E-25282No hitNo description
SuperFamilySSF554554.45E-25295IPR002100Transcription factor, MADS-box
PRINTSPR004042.6E-17323IPR002100Transcription factor, MADS-box
PfamPF003191.6E-191154IPR002100Transcription factor, MADS-box
PRINTSPR004042.6E-172338IPR002100Transcription factor, MADS-box
PRINTSPR004042.6E-173859IPR002100Transcription factor, MADS-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0010152Biological Processpollen maturation
GO:0080092Biological Processregulation of pollen tube growth
GO:0003677Molecular FunctionDNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 357 aa     Download sequence    Send to blast
MGRVKLKIKR LENSSSRQVT YSKRKAGILK KAKELSILCD IDLVLLMFAP NGKPTICVGD  60
RSNIEEVVAR FAQVSPQERA KRKLESLEAL RKTFKKLDHD VNIQEFLGSS TQTVEELTNH  120
LRSLHGQILD VQKRLSYWTD PDKISNIDHI RAMEQSLKES LSRIQAHKEN YGKQLISLEC  180
SGQFQNDMHL SSGLGCAQGA SPLQWLHNND GQQLMLPQDA NLIPQRDVGC STDTSLQNYP  240
AYFSTGKQTD ANEPVQEDSL HEFSPNACLR LQLGGQYPYQ SYGQNLLSDR TFKPDAENSL  300
QESTIDYQVN QFETPRSGYD ASFQNWASTS GTCGVAIYDE QSYTQVSFRR IFTFTIT
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor that forms a heterodimer with the MADS-box protein AGL104 and is involved in the regulation of pollen maturation at the late stages of pollen development and pollen tube growth. {ECO:0000269|PubMed:19211705}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009393193.10.0PREDICTED: agamous-like MADS-box protein AGL65
RefseqXP_018678666.10.0PREDICTED: agamous-like MADS-box protein AGL65
RefseqXP_018678667.10.0PREDICTED: agamous-like MADS-box protein AGL65
SwissprotQ7X9I01e-89AGL65_ARATH; Agamous-like MADS-box protein AGL65
TrEMBLM0SHD30.0M0SHD3_MUSAM; Uncharacterized protein
STRINGGSMUA_Achr3P24170_0010.0(Musa acuminata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP46263659
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G18750.14e-92AGAMOUS-like 65
Publications ? help Back to Top
  1. Zhang S, et al.
    FERTILIZATION-INDEPENDENT SEED-Polycomb Repressive Complex 2 Plays a Dual Role in Regulating Type I MADS-Box Genes in Early Endosperm Development.
    Plant Physiol., 2018. 177(1): p. 285-299
    [PMID:29523711]