PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID GSMUA_Achr3P22470_001
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Zingiberales; Musaceae; Musa
Family bZIP
Protein Properties Length: 256aa    MW: 27436.9 Da    PI: 8.6481
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
GSMUA_Achr3P22470_001genomeCIRADView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_151.13e-16172225356
                            XXCHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
                 bZIP_1   3 elkrerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelkkev 56 
                            +l+r++r++kNRe+A rsR+RK+a+i+eLe  v++Le+eN +L    e+ +k+ 
  GSMUA_Achr3P22470_001 172 ALQRQKRMIKNRESAARSRERKQAYIAELESLVAQLEEENAQLLRSQEQQQKMR 225
                            79**************************************99876666655554 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.20.5.1704.9E-14163232No hitNo description
SMARTSM003381.7E-10170234IPR004827Basic-leucine zipper domain
PfamPF001706.8E-15171227IPR004827Basic-leucine zipper domain
PROSITE profilePS5021710.588172223IPR004827Basic-leucine zipper domain
CDDcd147072.23E-22174224No hitNo description
SuperFamilySSF579593.38E-11175222No hitNo description
PROSITE patternPS000360177192IPR004827Basic-leucine zipper domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 256 aa     Download sequence    Send to blast
MASSRVMASS SSANSDLTRQ SSICSLPVTD LQSSISGGGE LTKNLGSMSM DDLFRNICGD  60
NPVAFAGGAE GGVSVSRQGS FAFPKSVGEK SVDEVWREIT AGRKADGGDG PGSEMTLEDF  120
LARAGAVGED DVGVPSGSSQ NPALGLGNGA EGVGKVGRGK KRSVLDPVDR AALQRQKRMI  180
KNRESAARSR ERKQAYIAEL ESLVAQLEEE NAQLLRSQEQ QQKMRVKQLL ENIVPVTEMK  240
KPRRILRRTC SMECLF
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009393411.11e-167PREDICTED: G-box-binding factor 4-like isoform X1
TrEMBLM0SGW30.0M0SGW3_MUSAM; Uncharacterized protein
STRINGGSMUA_Achr3P22470_0010.0(Musa acuminata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP26653786
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G03970.17e-36G-box binding factor 4