PlantTFDB
Plant Transcription Factor Database
v5.0
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID GSMUA_Achr3P19060_001
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Zingiberales; Musaceae; Musa
Family ZF-HD
Protein Properties Length: 240aa    MW: 25185.5 Da    PI: 10.6452
Description ZF-HD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
GSMUA_Achr3P19060_001genomeCIRADView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1ZF-HD_dimer993.5e-312778456
            ZF-HD_dimer  4 vrYkeClkNhAaslGghavDGCgEfmpsegeegtaaalkCaACgCHRnFHRre 56
                           +rY+eCl+NhAa++Gg+a+DGCgEfmp+ gee + +alkCaACgCHRnFHRre
  GSMUA_Achr3P19060_001 27 ARYRECLRNHAAAMGGQAYDGCGEFMPA-GEEDSLDALKCAACGCHRNFHRRE 78
                           79*************************9.8888*******************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF047704.1E-282778IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
TIGRFAMsTIGR015667.6E-292878IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
PROSITE profilePS5152327.7522978IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
ProDomPD1257746.0E-173278IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
PRINTSPR012171.3E-108197No hitNo description
PRINTSPR012171.3E-10104116No hitNo description
PRINTSPR012171.3E-10178194No hitNo description
PRINTSPR012171.3E-10195212No hitNo description
Sequence ? help Back to Top
Protein Sequence    Length: 240 aa     Download sequence    Send to blast
MDLSVVPYTG GREEEAEGAG GGGGGGARYR ECLRNHAAAM GGQAYDGCGE FMPAGEEDSL  60
DALKCAACGC HRNFHRREGL SQPPPPQFPA FLPAPMPLPY HAMQPPPLAA ALPLPPRPPR  120
RPGPASGSAP GSRRSRRRRC RPSRRSWGGV SRSKTTSRST SSASRSASSG TSSRSGCTTT  180
RATSPRPHPP PPPPTPPPPT PPPATPPPPP PPPLPSTPNQ ILSYDIGFPP ILALITFHVW
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
TrEMBLM0SFX21e-164M0SFX2_MUSAM; Uncharacterized protein
STRINGGSMUA_Achr3P19060_0011e-165(Musa acuminata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP143134120
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G02540.11e-21homeobox protein 21