PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID GSMUA_Achr3P12320_001
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Zingiberales; Musaceae; Musa
Family TCP
Protein Properties Length: 202aa    MW: 20920.3 Da    PI: 4.1881
Description TCP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
GSMUA_Achr3P12320_001genomeCIRADView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1TCP75.71.3e-231502473
                    TCP 24 lsaecaarfFdLqdeLGfdkdsktieWLlqqakpaikeltgtssssasec 73
                           ++a caar+F+L++eLG+++d++ti WLlq a+pai+++tgt++ +a ++
  GSMUA_Achr3P12320_001  1 MPAACAARIFQLTRELGHKSDGETIRWLLQHAEPAIIAATGTGTVPAIAT 50
                           9*****************************************77777333 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF036344.2E-18154IPR005333Transcription factor, TCP
PROSITE profilePS5136920.428139IPR017887Transcription factor TCP subgroup
Sequence ? help Back to Top
Protein Sequence    Length: 202 aa     Download sequence    Send to blast
MPAACAARIF QLTRELGHKS DGETIRWLLQ HAEPAIIAAT GTGTVPAIAT VVDGAIKIPT  60
EAPSSSSAGL TAVTAFYPVQ DPLLQGALWM LPQPTAMVEP SGQAQIWTFP AASQIINLGG  120
PHPMAATAVY PGAAPGPNVA TAAGGGEPRT NEQAVTSTDG KKQELQLMGG ARGRRRDALL  180
ETEEESESDA EEEPPSESDA ED
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009391944.11e-113PREDICTED: transcription factor PCF2-like
TrEMBLM0SDZ91e-142M0SDZ9_MUSAM; Uncharacterized protein
STRINGGSMUA_Achr3P12320_0011e-143(Musa acuminata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP39123167
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G45680.12e-31TCP family protein