PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID GSMUA_Achr3P02200_001
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Zingiberales; Musaceae; Musa
Family GeBP
Protein Properties Length: 274aa    MW: 29976.4 Da    PI: 10.2114
Description GeBP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
GSMUA_Achr3P02200_001genomeCIRADView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF57378.88.6e-2563157297
                 DUF573   2 lfqrlwseeDeivlLqGlidfkaktgkspsddidafyefvkksisfkvsksqlveKirrLKkKfkkkvkkaksgkepsfskehdqkif 89 
                            +fqr+wse+ ei +LqGl+ +  ++g     d++ f++ +++s+   +++sql+eK+rrL+kKf+  ++++++g++p+  ++hd++++
  GSMUA_Achr3P02200_001  63 RFQRVWSESEEIRFLQGLLGC-WSQGLVFPRDLNLFFDRFSESMPQPYTRSQLSEKLRRLRKKFRVTSARVARGHDPARLAPHDRDVL 149
                            69*******************.677988888********************************************************* PP

                 DUF573  90 elskkiWg 97 
                            +l++++W+
  GSMUA_Achr3P02200_001 150 HLCNRLWH 157
                            *******7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF045041.3E-2364157IPR007592Protein of unknown function DUF573
Sequence ? help Back to Top
Protein Sequence    Length: 274 aa     Download sequence    Send to blast
MAASTPTHIE PSPPAAPAAA DPPRKLPIKR KKAPHPTPIP SPAAAASAGD QIDVRSAAAA  60
PFRFQRVWSE SEEIRFLQGL LGCWSQGLVF PRDLNLFFDR FSESMPQPYT RSQLSEKLRR  120
LRKKFRVTSA RVARGHDPAR LAPHDRDVLH LCNRLWHPSY AASSPFSAPD VGCTAASTST  180
NAAHLGLKLG KEPLPPGMGA DEAAVGKDET RHLMAKIVLS VFDACLAELK VTAASQGLGC  240
QGNDLEKRWQ EQRVAEMDVL ARRLRMVLEK AIQN
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_026658276.16e-73probable transcription factor At4g00390
TrEMBLM0SB380.0M0SB38_MUSAM; Uncharacterized protein
STRINGGSMUA_Achr3P02200_0010.0(Musa acuminata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP86953243
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G04930.25e-13DNA-binding storekeeper protein-related transcriptional regulator