PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID GSMUA_Achr2P23020_001
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Zingiberales; Musaceae; Musa
Family Dof
Protein Properties Length: 275aa    MW: 29882 Da    PI: 7.5546
Description Dof family protein
Gene Model
Gene Model ID Type Source Coding Sequence
GSMUA_Achr2P23020_001genomeCIRADView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-Dof124.82.7e-392887261
                 zf-Dof  2 kekalkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknkks 61
                           +++alkcprCdst+tkfCyynnyslsqPry+Ck+CrryWtkGG+lrnvPvGgg+rknk+s
  GSMUA_Achr2P23020_001 28 HDQALKCPRCDSTHTKFCYYNNYSLSQPRYLCKTCRRYWTKGGTLRNVPVGGGCRKNKRS 87
                           7899******************************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
ProDomPD0074781.0E-282686IPR003851Zinc finger, Dof-type
PfamPF027011.9E-332986IPR003851Zinc finger, Dof-type
PROSITE profilePS5088428.8823286IPR003851Zinc finger, Dof-type
PROSITE patternPS0136103470IPR003851Zinc finger, Dof-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 275 aa     Download sequence    Send to blast
MDSSSPSSEV MSCSRPPPVM EERLRPQHDQ ALKCPRCDST HTKFCYYNNY SLSQPRYLCK  60
TCRRYWTKGG TLRNVPVGGG CRKNKRSGAK KTADLLHPSA SSSLKEATSS CLHQPFPLVQ  120
LPHLESIFTN TCRNIDFMEC KYDLMLDNPM DGLDLMDGKL GAILTRNQLP LGGVNPGLGE  180
AASHGSASAS FHSMIGTCGF CIDGNHAGLM EACRGLALPF DGHEESNSVE VKPGDWINLS  240
TQWADQCCVD AGRAVMGCDK GLASWAGLMN GMAPR
Functional Description ? help Back to Top
Source Description
UniProtTranscription factor that binds specifically to a 5'-AA[AG]G-3' consensus core sequence (By similarity). Promotes expression (PubMed:19915089). The PEAR proteins (e.g. DOF2.4, DOF5.1, DOF3.2, DOF1.1, DOF5.6 and DOF5.3) activate gene expression that promotes radial growth of protophloem sieve elements (PubMed:30626969). Involved in the regulation of interfascicular cambium formation and vascular tissue development, particularly at a very early stage during inflorescence stem development; promotes both cambium activity and phloem specification, but prevents xylem specification (PubMed:19915089). {ECO:0000250|UniProtKB:Q9M2U1, ECO:0000269|PubMed:19915089, ECO:0000269|PubMed:30626969}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAP0150355e-32AP015035.1 Vigna angularis var. angularis DNA, chromosome 2, almost complete sequence, cultivar: Shumari.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009390178.10.0PREDICTED: dof zinc finger protein DOF5.6-like
SwissprotQ9FM039e-34DOF56_ARATH; Dof zinc finger protein DOF5.6
TrEMBLM0SAE30.0M0SAE3_MUSAM; Uncharacterized protein
STRINGGSMUA_Achr2P23020_0010.0(Musa acuminata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP47043263
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G60200.19e-35TARGET OF MONOPTEROS 6
Publications ? help Back to Top
  1. Miyashima S, et al.
    Mobile PEAR transcription factors integrate positional cues to prime cambial growth.
    Nature, 2019. 565(7740): p. 490-494
    [PMID:30626969]