PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID GSMUA_Achr2P21580_001
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Zingiberales; Musaceae; Musa
Family GeBP
Protein Properties Length: 346aa    MW: 37093.7 Da    PI: 6.7978
Description GeBP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
GSMUA_Achr2P21580_001genomeCIRADView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF573842e-26127221297
                 DUF573   2 lfqrlwseeDeivlLqGlidfkaktgkspsddidafyefvkksisfkvsksqlveKirrLKkKfkkkvkkaksgkepsfskehdqkif 89 
                            +fqr+wse+Dei +LqGl+ +  ++g     d++ f++ +++s+   +++sql+eK+rrL+kKf+ +++++++g++p+  ++hd++++
  GSMUA_Achr2P21580_001 127 RFQRVWSESDEIRFLQGLLGC-WSQGLVFPRDLNLFFDRFSESMPQPYTRSQLSEKLRRLRKKFRVMSSRIARGQDPARLAPHDRDVL 213
                            69*******************.677988888********************************************************* PP

                 DUF573  90 elskkiWg 97 
                            +l+ ++W+
  GSMUA_Achr2P21580_001 214 HLCTRLWH 221
                            *******7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF045044.2E-25128221IPR007592Protein of unknown function DUF573
Sequence ? help Back to Top
Protein Sequence    Length: 346 aa     Download sequence    Send to blast
MAAPTPTPIP LAQIESSTAS PAAAAVAAAA AAAAPPPSKL PIKRKKTPQP HSQEQAQPHL  60
SSPDPLLVPA PSSSSSDPPL AADQGFDEDD DYDDGDDDYG AAAAAGSAAP IDVRAGGASA  120
AAAPPFRFQR VWSESDEIRF LQGLLGCWSQ GLVFPRDLNL FFDRFSESMP QPYTRSQLSE  180
KLRRLRKKFR VMSSRIARGQ DPARLAPHDR DVLHLCTRLW HPSYAASSPF SAPDALAPGS  240
GGNKQKEVKV EKEEKPLSGV GRDEVAPGID VPRHLLAKTI LDVFDACLNE FKVTVAGQGL  300
VFPGGSASSG AAGRSDLEQR WREQRVTELD VLGRRLRLVL EKTIQN
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_018675600.11e-119PREDICTED: probable transcription factor At3g04930 isoform X1
TrEMBLM0S9Z90.0M0S9Z9_MUSAM; Uncharacterized protein
STRINGGSMUA_Achr2P21580_0010.0(Musa acuminata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP86953243
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G04930.29e-14DNA-binding storekeeper protein-related transcriptional regulator