PlantTFDB
Plant Transcription Factor Database
v5.0
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID GSMUA_Achr2P20490_001
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Zingiberales; Musaceae; Musa
Family bZIP
Protein Properties Length: 243aa    MW: 26695.1 Da    PI: 5.4603
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
GSMUA_Achr2P20490_001genomeCIRADView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_150.64.2e-16162213455
                            XCHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
                 bZIP_1   4 lkrerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelkke 55 
                            l+r++r++kNRe+A rsR+RK+a++ eLe  v  Le+eN +L  e ee  k+
  GSMUA_Achr2P20490_001 162 LRRQKRMIKNRESAARSRERKQAYTVELESLVTRLEEENVTLVREQEEQHKM 213
                            79****************************************9998887776 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.20.5.1706.6E-14156214No hitNo description
SMARTSM003381.3E-11159223IPR004827Basic-leucine zipper domain
PROSITE profilePS5021710.346161209IPR004827Basic-leucine zipper domain
PfamPF001704.0E-15162214IPR004827Basic-leucine zipper domain
SuperFamilySSF579595.31E-11162212No hitNo description
CDDcd147071.29E-20163213No hitNo description
PROSITE patternPS000360166181IPR004827Basic-leucine zipper domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 243 aa     Download sequence    Send to blast
MASPSSSASS DVARQSSAYA SAASCDQTEA LGSVSMDHLL RGFCAQPPFP LPLPRNAAGT  60
TADVVWEIPD GAGSGYEDAA AGADGEVTLE EFLARTGAVR EEDVGVSTGF VVDPAIGGRF  120
CQQEQQLPLE NPMLGFGSAL ESGGRRARKR VVLDDPVDKV VLRRQKRMIK NRESAARSRE  180
RKQAYTVELE SLVTRLEEEN VTLVREQEEQ HKMRFQQLMV NIIPVNESRK PLPVLRRTHS  240
MQW
Functional Description ? help Back to Top
Source Description
UniProtTranscription activator that binds to the ABA-responsive elements (ABREs) in vitro. Involved in abiotic stress responses and abscisic acid (ABA) signaling (PubMed:20039193). Involved in the signaling pathway that induces growth inhibition in response to D-allose (PubMed:23397192). {ECO:0000269|PubMed:20039193, ECO:0000269|PubMed:23397192}.
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: Induced by anoxia, drought, salt stress, oxidative stress, cold and abscisic acid (ABA) (PubMed:20039193). Induced by D-allose (PubMed:23397192). {ECO:0000269|PubMed:20039193, ECO:0000269|PubMed:23397192}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009390055.11e-179PREDICTED: G-box-binding factor 4-like isoform X2
SwissprotQ0JHF11e-36BZP12_ORYSJ; bZIP transcription factor 12
TrEMBLM0S9P01e-178M0S9P0_MUSAM; Uncharacterized protein
STRINGGSMUA_Achr2P20490_0011e-178(Musa acuminata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP26653786
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G44080.16e-27bZIP family protein
Publications ? help Back to Top
  1. Kikuchi S, et al.
    Collection, mapping, and annotation of over 28,000 cDNA clones from japonica rice.
    Science, 2003. 301(5631): p. 376-9
    [PMID:12869764]