PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID GSMUA_Achr2P18110_001
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Zingiberales; Musaceae; Musa
Family B3
Protein Properties Length: 214aa    MW: 23942.7 Da    PI: 8.3188
Description B3 family protein
Gene Model
Gene Model ID Type Source Coding Sequence
GSMUA_Achr2P18110_001genomeCIRADView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1B3314.4e-101381944199
                            TTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE-SSSEE..EEEEE-S CS
                     B3  41 esgrsWevkliyrkksgryvltkGWkeFvkangLkegDfvvFkldgrsefelvvkvfrk 99 
                              +r+W++k++ ++  +r  l +GWk+F+ + +Lk+gD +v++l+++++  ++v+++r+
  GSMUA_Achr2P18110_001 138 YGNRTWKMKYSCKGILRR--LCSGWKNFALDTDLKVGDGCVLELMDSNNILFKVQILRR 194
                            4679******77777777..889********************9988777788888876 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019366.28E-1498193IPR015300DNA-binding pseudobarrel domain
Gene3DG3DSA:2.40.330.101.3E-1199194IPR015300DNA-binding pseudobarrel domain
PROSITE profilePS508639.982102195IPR003340B3 DNA binding domain
CDDcd100177.06E-13109193No hitNo description
PfamPF023624.2E-8130194IPR003340B3 DNA binding domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 214 aa     Download sequence    Send to blast
MTRSGGRFAE ATNRSEEKEN NETGILLFFV IFLISFSPSA WFLVCGEEKS SNCILRISLC  60
RLSMDSSRGK NCESGDAELS PTEPPASAEK NEIVPLSGKP FLTFVVSWSH VHDPYQVLFP  120
KRFYPFLPAT CVPVTLSYGN RTWKMKYSCK GILRRLCSGW KNFALDTDLK VGDGCVLELM  180
DSNNILFKVQ ILRRGVVPVK RDKGLSCDAP ISID
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009388412.11e-109PREDICTED: B3 domain-containing protein Os04g0386900-like
RefseqXP_018676857.11e-109PREDICTED: B3 domain-containing protein Os04g0386900-like
TrEMBLM0S9021e-156M0S902_MUSAM; Uncharacterized protein
STRINGGSMUA_Achr2P18110_0011e-157(Musa acuminata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP89543545