PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID GSMUA_Achr2P10180_001
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Zingiberales; Musaceae; Musa
Family G2-like
Protein Properties Length: 456aa    MW: 50238.4 Da    PI: 6.5762
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
GSMUA_Achr2P10180_001genomeCIRADView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like102.52.6e-32244298155
                G2-like   1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55 
                            kpr+rWtpeLHe F++av+qLGG ekAtPk +l++mkv+gLt+ hvkSHLQkYR+
  GSMUA_Achr2P10180_001 244 KPRMRWTPELHELFIDAVNQLGGGEKATPKGVLNIMKVEGLTICHVKSHLQKYRT 298
                            79****************************************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129412.092241301IPR017930Myb domain
SuperFamilySSF466891.79E-17242298IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.606.8E-30243299IPR009057Homeodomain-like
TIGRFAMsTIGR015573.7E-25244298IPR006447Myb domain, plants
PfamPF002492.2E-9246297IPR001005SANT/Myb domain
PfamPF143797.0E-21330376IPR025756MYB-CC type transcription factor, LHEQLE-containing domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 456 aa     Download sequence    Send to blast
METRSALPMG KLNMEQLSDA RSSGVMSSTL PVRPNNSGEK FPKIPDSQLV LMDREIRSNP  60
LPSDYTPFVS DGGNVGPLFS SPSGLSSDLH FSSSLPHERH TNGTPFANQL LNAGVSLSST  120
YSSNTGIFQV PNNNLPKDPT AVTWCPETVQ GIGNSKINDS LIVVSNDLSK QNDWWSDIMN  180
VDWKDLLNDT TIAESQSKVV CPAAQSSPDI SMHQLQSHRS VPCHAGEVCS ITSPMSATTS  240
TATKPRMRWT PELHELFIDA VNQLGGGEKA TPKGVLNIMK VEGLTICHVK SHLQKYRTAR  300
YIPDSSEGMS EKRITQSEEL PSLNLKTGID FTEALRLQIE VQKRLHEQLE IQRSMQLRIE  360
EQAKRLQVMI EKQRKSTMEK QHASSTPLEP TPHSTAEIEL PEGGNSSSSI QRTEDSRQVG  420
NKWKMPELET SNKKGTDAIT GCPSTSKHIR VSNEDA
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
6j4k_A8e-28244301259Protein PHOSPHATE STARVATION RESPONSE 1
6j4k_B8e-28244301259Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_A8e-28244301259Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_C8e-28244301259Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_D8e-28244301259Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_F8e-28244301259Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_H8e-28244301259Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_J8e-28244301259Protein PHOSPHATE STARVATION RESPONSE 1
Search in ModeBase
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009389282.10.0PREDICTED: protein PHOSPHATE STARVATION RESPONSE 2 isoform X1
RefseqXP_009389283.10.0PREDICTED: protein PHOSPHATE STARVATION RESPONSE 2 isoform X1
RefseqXP_009389284.10.0PREDICTED: protein PHOSPHATE STARVATION RESPONSE 2 isoform X1
RefseqXP_018676242.10.0PREDICTED: protein PHOSPHATE STARVATION RESPONSE 2 isoform X1
TrEMBLM0S6Q90.0M0S6Q9_MUSAM; Uncharacterized protein
STRINGGSMUA_Achr2P10180_0010.0(Musa acuminata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP19713789
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G28610.13e-63phosphate starvation response 1