PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID GSMUA_Achr2P01740_001
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Zingiberales; Musaceae; Musa
Family M-type_MADS
Protein Properties Length: 341aa    MW: 38528 Da    PI: 5.4164
Description M-type_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
GSMUA_Achr2P01740_001genomeCIRADView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF68.37.1e-22953145
                           S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSE CS
                 SRF-TF  1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgk 45
                           kr en+s rqvt+skR++g++KKA+ELS+LCd++  +++f+++gk
  GSMUA_Achr2P01740_001  9 KRLENSSSRQVTYSKRKAGVMKKAKELSILCDIDLVLLMFAPNGK 53
                           789****************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5006624.292153IPR002100Transcription factor, MADS-box
SMARTSM004327.9E-30160IPR002100Transcription factor, MADS-box
SuperFamilySSF554554.45E-25295IPR002100Transcription factor, MADS-box
CDDcd002661.21E-25282No hitNo description
PRINTSPR004043.2E-17323IPR002100Transcription factor, MADS-box
PfamPF003191.5E-191155IPR002100Transcription factor, MADS-box
PRINTSPR004043.2E-172338IPR002100Transcription factor, MADS-box
PRINTSPR004043.2E-173859IPR002100Transcription factor, MADS-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 341 aa     Download sequence    Send to blast
MGRVKLKIKR LENSSSRQVT YSKRKAGVMK KAKELSILCD IDLVLLMFAP NGKPTVCVGD  60
RSNIEEVVAR FSQVSQQERA KRKLESLEAL KKTFKKLDHD VNIQEFLGPS TQTVEELASY  120
LGSLHGQLLD VQKRLSYWAD PDEISDIDHI RAMEQSLKES LSRIQAHKEN FGRQLISVDC  180
CGQFQNDIHL HSGFNYEQGA SPVSWLHNND GQQLMLPQDS NLLSQRDIGC SADTPLQNCN  240
AYFSTGEQTD ANEQVQEGSL HEYSPNACLR LQLGGQYPYQ SYCQNLVSER TFKPDAENSL  300
QESTIDYQVN HFDASFQNWA STSATCGVSM YDEQSYTQVS F
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
6byy_A5e-13192190MEF2 CHIMERA
6byy_B5e-13192190MEF2 CHIMERA
6byy_C5e-13192190MEF2 CHIMERA
6byy_D5e-13192190MEF2 CHIMERA
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor that forms a heterodimer with the MADS-box protein AGL104 and is involved in the regulation of pollen maturation at the late stages of pollen development and pollen tube growth. {ECO:0000269|PubMed:19211705}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009381113.10.0PREDICTED: agamous-like MADS-box protein AGL65 isoform X1
SwissprotQ7X9I05e-81AGL65_ARATH; Agamous-like MADS-box protein AGL65
TrEMBLM0S4B50.0M0S4B5_MUSAM; Uncharacterized protein
STRINGGSMUA_Achr2P01740_0010.0(Musa acuminata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP46263659
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G18750.12e-83AGAMOUS-like 65
Publications ? help Back to Top
  1. Zhang S, et al.
    FERTILIZATION-INDEPENDENT SEED-Polycomb Repressive Complex 2 Plays a Dual Role in Regulating Type I MADS-Box Genes in Early Endosperm Development.
    Plant Physiol., 2018. 177(1): p. 285-299
    [PMID:29523711]