PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID GSMUA_Achr1P27380_001
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Zingiberales; Musaceae; Musa
Family VOZ
Protein Properties Length: 282aa    MW: 31079.4 Da    PI: 4.648
Description VOZ family protein
Gene Model
Gene Model ID Type Source Coding Sequence
GSMUA_Achr1P27380_001genomeCIRADView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1VOZ176.51.2e-541732821112
                    VOZ   1 pppsaflgpkcalwdctrpaqgsewlqdycssfhatlalneglpgttpvlrpkgidlkdgllfaalsakvqgkevgipecegaataks 88 
                            pppsafl+pkcalwdc+rpaqgsew++dycssfh+tla+ne++pg+t vlrp+gidlkdg+lf alsak+qgk vgip+cega   +s
  GSMUA_Achr1P27380_001 173 PPPSAFLRPKCALWDCPRPAQGSEWCRDYCSSFHTTLAINEDMPGMTLVLRPGGIDLKDGPLFTALSAKIQGKIVGIPVCEGA---RS 257
                            89********************************************************************************8...79 PP

                    VOZ  89 pwnaael.fdlsllegetirewlff 112
                            pwna+ + +dl++le e++rewlff
  GSMUA_Achr1P27380_001 258 PWNASGMaIDLCVLEDESLREWLFF 282
                            ****98758***************9 PP

Sequence ? help Back to Top
Protein Sequence    Length: 282 aa     Download sequence    Send to blast
MGTGCKSALH HLHRDKARNR VDDLQSAIKD CRAADVAVLE EQVYQRLREC WAELNQPSPT  60
TSLQVIESEA DLSFCLFTLR LLQLSEEEDD ATSKLAELAF GNTPKPELVE LQQADVGAAQ  120
GGRAANFQEV NTNLIFFSLC SKLQTGPDNV TCHEGNGRNV FPYMSYVLPA ICPPPSAFLR  180
PKCALWDCPR PAQGSEWCRD YCSSFHTTLA INEDMPGMTL VLRPGGIDLK DGPLFTALSA  240
KIQGKIVGIP VCEGARSPWN ASGMAIDLCV LEDESLREWL FF
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009396504.11e-105PREDICTED: transcription factor VOZ1-like
SwissprotQ9SGQ07e-79VOZ1_ARATH; Transcription factor VOZ1
TrEMBLM0S3J50.0M0S3J5_MUSAM; Uncharacterized protein
STRINGGSMUA_Achr1P27380_0010.0(Musa acuminata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP23433888
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G28520.24e-80vascular plant one zinc finger protein