PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID GSMUA_Achr1P18840_001
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Zingiberales; Musaceae; Musa
Family GRAS
Protein Properties Length: 614aa    MW: 67549.1 Da    PI: 5.6901
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
GSMUA_Achr1P18840_001genomeCIRADView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS382.93.9e-1172345991373
                   GRAS   1 lvelLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlarsvselykalppsetsekn.sseelaalklfsev 87 
                            lv+lL++c e +ss++ e+ + +Larl e+a+p g+p++R++ayfteALa r a+  +++++  pp++ ++ +  ++ + al l+  v
  GSMUA_Achr1P18840_001 234 LVSLLTSCTESMSSSNYEAMSFFLARLGEMATPFGTPLHRVVAYFTEALALRAAKLLPHIFSVAPPKTITDPTdNDDDAIALLLLDCV 321
                            6899***********************************************************988876654449999999999**** PP

                   GRAS  88 sPilkfshltaNqaIleavegeervHiiDfdisqGlQWpaLlqaLasRpegppslRiTgvgspesgskeeleetgerLakfAeelgvp 175
                            sPi+kf h+t N+ +l+a+eg++rvHiiDfd++qGlQWpaL+q+LasRp++p ++RiTg+g+        l++ g rLa +Ae+l++p
  GSMUA_Achr1P18840_001 322 SPIPKFLHFTLNERLLKAFEGKDRVHIIDFDVKQGLQWPALFQSLASRPNPPGHVRITGIGE----CGPHLQQAGVRLAGIAESLDLP 405
                            **************************************************************....********************** PP

                   GRAS 176 fefnvlvakrledleleeLrvkpgEalaVnlvlqlhrlldesvsleserdevLklvkslsPkvvvvveqeadhnsesFlerflealey 263
                            fef++ v++rled++l++L+vk++E++aVn++l +h++l ++   +   +++L l++s++P++vv++eqea+hn++++ +r++ +l+y
  GSMUA_Achr1P18840_001 406 FEFHP-VVDRLEDIRLWMLHVKREECVAVNCALTMHKTLYDESGKA--LTDLLGLIRSTRPEIVVMAEQEAKHNEPTWETRLAGSLNY 490
                            *****.7******************************995554443..489************************************* PP

                   GRAS 264 ysalfdsleaklpreseerikvErellgreivnvvacegaerrerhetlekWrerleeaGFkpvplsekaakqaklllrkvksdgyrv 351
                            y+++fds+e  lp +s++rik+E++ +++ei+n+va eg+er+erhe++ +Wr+ +++ GF+ + ++e   +q +++ r+++ + y++
  GSMUA_Achr1P18840_001 491 YASVFDSMEHALPVDSQARIKIEEA-FAKEIRNIVAREGSERTERHESFDRWRKLMQDGGFRCLGIGEG--EQSRMIPRMYSCENYSI 575
                            *************************.****************************************986..68999999999888*** PP

                   GRAS 352 eee..sgslvlgWkdrpLvsvSaW 373
                            +e+   + l+l W ++pL++vSaW
  GSMUA_Achr1P18840_001 576 HEQgeGDGLTLKWLHQPLYTVSAW 599
                            9875477899************** PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098552.088208580IPR005202Transcription factor GRAS
PfamPF035141.3E-114234599IPR005202Transcription factor GRAS
Sequence ? help Back to Top
Protein Sequence    Length: 614 aa     Download sequence    Send to blast
MLAGCPLTLP SPGIDASVQL QPYHFQLQEK KHCPPQQTMG TQRLDLPCGF SSRKDPLRAV  60
LSGETPSAEA PGTSCSFRQH PVTHSSSSSL VAQAAAPWGR TVEAIDGRNG GPWEQRRSSK  120
RLHDRISCGD YRAKRTRTVD VEADAWPSPS TEEPPLVEAE EERVFLVPNA ASFPLPAFSG  180
HDRSRSETSS SSGAFICSGN TATSDGPRLP PASGFAGFGG EGEGIQTEQQ GLELVSLLTS  240
CTESMSSSNY EAMSFFLARL GEMATPFGTP LHRVVAYFTE ALALRAAKLL PHIFSVAPPK  300
TITDPTDNDD DAIALLLLDC VSPIPKFLHF TLNERLLKAF EGKDRVHIID FDVKQGLQWP  360
ALFQSLASRP NPPGHVRITG IGECGPHLQQ AGVRLAGIAE SLDLPFEFHP VVDRLEDIRL  420
WMLHVKREEC VAVNCALTMH KTLYDESGKA LTDLLGLIRS TRPEIVVMAE QEAKHNEPTW  480
ETRLAGSLNY YASVFDSMEH ALPVDSQARI KIEEAFAKEI RNIVAREGSE RTERHESFDR  540
WRKLMQDGGF RCLGIGEGEQ SRMIPRMYSC ENYSIHEQGE GDGLTLKWLH QPLYTVSAWA  600
PADVTDGPST SQPN
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5b3h_A8e-6522660110379Protein SCARECROW
5b3h_D8e-6522660110379Protein SCARECROW
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor involved in plant development. {ECO:0000250}.
UniProtProbable transcription factor that acts as positivie regulator of brassinosteroid (BR) signaling (PubMed:19220793, PubMed:22685166). Functions downstream of BRI1 and GSK2 to modulate BR responses. Acts as a direct target of GSK2 kinase to mediate BR responses (PubMed:22685166). Involved in feedback inhibition of BR biosynthetic genes. Repressed by BZR1 (PubMed:19220793). {ECO:0000269|PubMed:19220793, ECO:0000269|PubMed:22685166}.
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: Down-regulated by 24-epibrassinolide. {ECO:0000269|PubMed:19220793}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009412565.10.0PREDICTED: scarecrow-like protein 28
SwissprotQ9CAN31e-144SCL28_ARATH; Scarecrow-like protein 28
SwissprotQ9LWU91e-144DLT_ORYSJ; Protein DWARF AND LOW-TILLERING
TrEMBLM0S1420.0M0S142_MUSAM; Uncharacterized protein
STRINGGSMUA_Achr1P18840_0010.0(Musa acuminata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP64043455
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G63100.11e-141GRAS family protein
Publications ? help Back to Top
  1. Tong H,Chu C
    Roles of DLT in fine modulation on brassinosteroid response in rice.
    Plant Signal Behav, 2009. 4(5): p. 438-9
    [PMID:19816111]
  2. Li W, et al.
    Identification and characterization of dwarf 62, a loss-of-function mutation in DLT/OsGRAS-32 affecting gibberellin metabolism in rice.
    Planta, 2010. 232(6): p. 1383-96
    [PMID:20830595]
  3. Tong H, et al.
    DWARF AND LOW-TILLERING acts as a direct downstream target of a GSK3/SHAGGY-like kinase to mediate brassinosteroid responses in rice.
    Plant Cell, 2012. 24(6): p. 2562-77
    [PMID:22685166]
  4. Zhang C,Bai MY,Chong K
    Brassinosteroid-mediated regulation of agronomic traits in rice.
    Plant Cell Rep., 2014. 33(5): p. 683-96
    [PMID:24667992]
  5. Yang C,Shen W,He Y,Tian Z,Li J
    OVATE Family Protein 8 Positively Mediates Brassinosteroid Signaling through Interacting with the GSK3-like Kinase in Rice.
    PLoS Genet., 2016. 12(6): p. e1006118
    [PMID:27332964]