PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID GSMUA_Achr1P16230_001
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Zingiberales; Musaceae; Musa
Family GRAS
Protein Properties Length: 356aa    MW: 40515.5 Da    PI: 6.5097
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
GSMUA_Achr1P16230_001genomeCIRADView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS369.35e-113234031373
                   GRAS  31 aspdgdpmqRlaayfteALaarlarsvselykal.ppsetseknsseelaalklfsevsPilkfshltaNqaIleavegeervHiiDf 117
                            a+p g+p++Rl+ayfte La r+ar  ++++ +  pp++  + ++++ ++al+l+  +sPi+kf h+t N+++l+a+eg +rvH+iD+
  GSMUA_Achr1P16230_001   2 ATPMGTPVHRLVAYFTESLALRVARLYPHIFTINaPPRRLIDASEEDDATALQLLDLISPIPKFLHFTLNEMLLKAFEGRDRVHVIDL 89 
                            7899***************************98867777778889999**************************************** PP

                   GRAS 118 disqGlQWpaLlqaLasRpegppslRiTgvgspesgskeeleetgerLakfAeelgvpfefnvlvakrledleleeLrvkpgEalaVn 205
                            di+qGlQWp+Llq+LasRp++p ++RiTgvg+    s+  l++tg rLa++Ae+l++pfef++ v++r+edl+l++L+vk++E++aV+
  GSMUA_Achr1P16230_001  90 DIKQGLQWPSLLQSLASRPRPPSHVRITGVGE----SRPDLHATGVRLARIAESLHLPFEFHP-VVDRFEDLRLWMLHVKREECVAVS 172
                            ********************************....9**************************.7*********************** PP

                   GRAS 206 lvlqlhrlldesvsleserdevLklvkslsPkvvvvveqeadhnsesFlerflealeyysalfdsleaklpreseerikvErellgre 293
                            ++l++hr l+++   +    ++L l++s++P  vv++eqea+hn++++ +r++++l++y+a+fdsl+  lp++s++rikvE+  +++e
  GSMUA_Achr1P16230_001 173 CSLMMHRALHDESGKA--FMDLLGLIRSTNPATVVMAEQEAEHNEPDWGRRLARSLNHYAAIFDSLDDVLPQDSHARIKVEEL-FAKE 257
                            *******996554444..489************************************************************98.**** PP

                   GRAS 294 ivnvvacegaerrerhetlekWrerlee.aGFkpvplsekaakqaklllrkvksdgyrve..eesgslvlgWkdrpLvsvSaW 373
                            i+n+vaceg+er+erhe+++ Wr+r+++  GF+ + ++e+++ q +++lr+++ d y+++   e + l+l W ++pL++vSaW
  GSMUA_Achr1P16230_001 258 IRNIVACEGDERIERHESFQGWRRRMTQeGGFTCLGIGEREMLQSRMILRMYSCDKYSIDveGEGHGLTLKWLHQPLYTVSAW 340
                            **************************98689**********************8889987425577888************** PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098550.2531319IPR005202Transcription factor GRAS
PfamPF035141.7E-1102340IPR005202Transcription factor GRAS
Sequence ? help Back to Top
Protein Sequence    Length: 356 aa     Download sequence    Send to blast
MATPMGTPVH RLVAYFTESL ALRVARLYPH IFTINAPPRR LIDASEEDDA TALQLLDLIS  60
PIPKFLHFTL NEMLLKAFEG RDRVHVIDLD IKQGLQWPSL LQSLASRPRP PSHVRITGVG  120
ESRPDLHATG VRLARIAESL HLPFEFHPVV DRFEDLRLWM LHVKREECVA VSCSLMMHRA  180
LHDESGKAFM DLLGLIRSTN PATVVMAEQE AEHNEPDWGR RLARSLNHYA AIFDSLDDVL  240
PQDSHARIKV EELFAKEIRN IVACEGDERI ERHESFQGWR RRMTQEGGFT CLGIGEREML  300
QSRMILRMYS CDKYSIDVEG EGHGLTLKWL HQPLYTVSAW VPVDVAGSSS AHLSQI
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5hyz_A4e-45234033374GRAS family transcription factor containing p
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009406334.10.0PREDICTED: scarecrow-like protein 28
SwissprotQ9CAN31e-135SCL28_ARATH; Scarecrow-like protein 28
TrEMBLM0S0D10.0M0S0D1_MUSAM; Uncharacterized protein
STRINGGSMUA_Achr1P16230_0010.0(Musa acuminata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP64043455
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G63100.11e-136GRAS family protein