PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID GSMUA_Achr11P23850_001
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Zingiberales; Musaceae; Musa
Family Dof
Protein Properties Length: 265aa    MW: 28800 Da    PI: 7.6238
Description Dof family protein
Gene Model
Gene Model ID Type Source Coding Sequence
GSMUA_Achr11P23850_001genomeCIRADView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-Dof124.73e-393091263
                  zf-Dof  2 kekalkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknkksss 63
                            +e+al+cprC stntkfCyynnyslsqPryfCk+CrryWt+GG+lrnvPvGgg+rk k+sss
  GSMUA_Achr11P23850_001 30 PEHALQCPRCASTNTKFCYYNNYSLSQPRYFCKGCRRYWTQGGSLRNVPVGGGCRKTKRSSS 91
                            67899*****************************************************9875 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
ProDomPD0074781.0E-242383IPR003851Zinc finger, Dof-type
PfamPF027011.9E-333288IPR003851Zinc finger, Dof-type
PROSITE profilePS5088429.0313488IPR003851Zinc finger, Dof-type
PROSITE patternPS0136103672IPR003851Zinc finger, Dof-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 265 aa     Download sequence    Send to blast
MCSRGLEEVV ACPKTQQQQQ QQDRKARPHP EHALQCPRCA STNTKFCYYN NYSLSQPRYF  60
CKGCRRYWTQ GGSLRNVPVG GGCRKTKRSS SSSSKKAAPF LVPSPLSHDP SDDLTSLQKP  120
LPMKQFGSDH ENGHNFLVGN TNTDPFSFLV NDSDPMPSAP TPTKGFLDYL RNGLVDISSP  180
SSFSNIDYDY GLGTSGSWGM PTGAGLSGAT AGTTTCQGSC KPMDGGDGHV EMSLLWQDGS  240
MDSERDYCWN GVGPSWQGLI NSSLL
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009384803.10.0PREDICTED: dof zinc finger protein DOF5.3-like isoform X1
TrEMBLM0RUW50.0M0RUW5_MUSAM; Uncharacterized protein
STRINGGSMUA_Achr11P23850_0010.0(Musa acuminata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP47043263
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G24060.14e-32Dof family protein