PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID GSMUA_Achr11P14990_001
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Zingiberales; Musaceae; Musa
Family bZIP
Protein Properties Length: 448aa    MW: 48764.9 Da    PI: 6.421
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
GSMUA_Achr11P14990_001genomeCIRADView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_132.71.6e-10226284563
                             CHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
                  bZIP_1   5 krerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelkkevaklksev 63 
                             kr++r   NR +A rs +RK  +i+eLe+kv++L++e ++L  +l +l+     l+ e+
  GSMUA_Achr11P14990_001 226 KRAKRILANRQSAARSKERKMRYIAELERKVQTLQTEATTLSAQLTMLQRDTNGLTVEN 284
                             9**********************************************998887777766 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003383.6E-17222286IPR004827Basic-leucine zipper domain
PROSITE profilePS5021711.001224287IPR004827Basic-leucine zipper domain
PfamPF001701.2E-8226278IPR004827Basic-leucine zipper domain
SuperFamilySSF579597.03E-11226277No hitNo description
Gene3DG3DSA:1.20.5.1706.6E-11226280No hitNo description
CDDcd147031.03E-23227276No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 448 aa     Download sequence    Send to blast
MDKDKSPASG GGGGGSGGGF PSHSSRYAPF GSSSGSFGFI GDHPSASSSS QPPPDSGQFG  60
HATRSDAERF SYDVSRMPDF PPRNPGHRRA HSEILSLPDD ISFDGDLGVV GSYDGPSLSD  120
ETEEDLVSMY MDVEKFSSGA TSSGLSIGES SLPVLSPVQA PSEGENVAFG STERPRIRHQ  180
HSQSLDGSTA IKPELLMSGG EGPSSVEAKK AMSAAKLAEL ALVDPKRAKR ILANRQSAAR  240
SKERKMRYIA ELERKVQTLQ TEATTLSAQL TMLQRDTNGL TVENNELKLR LQTMEQQVHL  300
QDALNEALRE EVQRLKLATG QMLPNGGQMV NLVPSSFGAN QQFYHHNQGM QSLLAAHQLQ  360
QLQIHSQHPQ QLQQQPQQQQ PLHSQTPQHQ QQPQPHQTQQ QPQQQQALHP LTLQQQRQPP  420
AADLRLKGPL TSQNQLGEMA SDEQNAHE
Functional Description ? help Back to Top
Source Description
UniProtPutative transcription factor with an activatory role.
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00126DAPTransfer from AT1G06070Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009383807.10.0PREDICTED: probable transcription factor PosF21
SwissprotQ040881e-137POF21_ARATH; Probable transcription factor PosF21
TrEMBLM0RSC90.0M0RSC9_MUSAM; Uncharacterized protein
STRINGGSMUA_Achr11P14990_0010.0(Musa acuminata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP42693868
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G06070.11e-140bZIP family protein
Publications ? help Back to Top
  1. Duarte JM, et al.
    Expression pattern shifts following duplication indicative of subfunctionalization and neofunctionalization in regulatory genes of Arabidopsis.
    Mol. Biol. Evol., 2006. 23(2): p. 469-78
    [PMID:16280546]
  2. Xu C, et al.
    Control of auxin-induced callus formation by bZIP59-LBD complex in Arabidopsis regeneration.
    Nat Plants, 2018. 4(2): p. 108-115
    [PMID:29358751]