PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID GSMUA_Achr11P14240_001
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Zingiberales; Musaceae; Musa
Family M-type_MADS
Protein Properties Length: 228aa    MW: 25971.7 Da    PI: 8.6039
Description M-type_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
GSMUA_Achr11P14240_001genomeCIRADView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF57.32.1e-18953145
                            S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSE CS
                  SRF-TF  1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgk 45
                            kr en+  rqvt+skR+ g+  KA+ELS+LCd++  +++f+++gk
  GSMUA_Achr11P14240_001  9 KRLENSNSRQVTYSKRKIGLTNKAKELSILCDIDLVLLMFAPNGK 53
                            789****************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5006623.016153IPR002100Transcription factor, MADS-box
SMARTSM004323.1E-25160IPR002100Transcription factor, MADS-box
CDDcd001206.29E-22254No hitNo description
SuperFamilySSF554551.16E-22293IPR002100Transcription factor, MADS-box
PRINTSPR004045.5E-16323IPR002100Transcription factor, MADS-box
PfamPF003196.4E-181154IPR002100Transcription factor, MADS-box
PRINTSPR004045.5E-162338IPR002100Transcription factor, MADS-box
PRINTSPR004045.5E-163859IPR002100Transcription factor, MADS-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 228 aa     Download sequence    Send to blast
MGRVKLKIKR LENSNSRQVT YSKRKIGLTN KAKELSILCD IDLVLLMFAP NGKPTICVGD  60
RSNTEEVVAR FAQVSQQEKG KKACSNSHWL LNKTFKKLDH DVDIQEFLGS STQTVEEITN  120
HWSSLHGQLL DVQKRLSNWA DPDKIDNINH ITTMEQSLKE SLGQIQVHKE NFGKQLISVD  180
YSGQVKCLFS RVLPFKCCEQ GASPVSWLHI NDDQQLMLPQ DANLLPWR
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_018675710.11e-125PREDICTED: agamous-like MADS-box protein AGL65
TrEMBLM0RS541e-168M0RS54_MUSAM; Uncharacterized protein
STRINGGSMUA_Achr11P14240_0011e-169(Musa acuminata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP46263659
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G18750.12e-66AGAMOUS-like 65