PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID GSMUA_Achr11P12720_001
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Zingiberales; Musaceae; Musa
Family bZIP
Protein Properties Length: 374aa    MW: 40863.4 Da    PI: 6.4102
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
GSMUA_Achr11P12720_001genomeCIRADView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_1315.4e-10192250563
                             CHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
                  bZIP_1   5 krerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelkkevaklksev 63 
                             kr++r   NR +A rs +RK+ +i+eLe+k+ +L++e ++L ++l + +    +l++e+
  GSMUA_Achr11P12720_001 192 KRAKRIWANRQSAARSKERKLRYIAELERKILTLQTEATTLSSQLTMFQTDNTALTAEN 250
                             9********************************************99999998888876 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003387.4E-14188252IPR004827Basic-leucine zipper domain
PROSITE profilePS502179.806190253IPR004827Basic-leucine zipper domain
SuperFamilySSF579594.98E-10192244No hitNo description
PfamPF001707.2E-8192247IPR004827Basic-leucine zipper domain
Gene3DG3DSA:1.20.5.1704.4E-10192247No hitNo description
CDDcd147036.80E-21193244No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 374 aa     Download sequence    Send to blast
MERDKSAVHE SGGLPPPPSS RFAAFASAST SSTLSAKCET PAVSPTPIDG HGGGRFSHDI  60
DRMPDNPPRN AGHRRAHSEI LSLPDDISFD SELGIVGSGE GPSLSDETEE DLISMYLDLD  120
KIASSSASSG LELQGTSGER PRVRHQHSQS FDGSTSIKPE LLASGTEGMS STEEKKAMSA  180
AKLAELALID PKRAKRIWAN RQSAARSKER KLRYIAELER KILTLQTEAT TLSSQLTMFQ  240
TDNTALTAEN NELKLRLQTM EQQVHLQDAL NETLRGEVQR LKIATGTAIA NGAQMVNYTQ  300
TSSSGVGQQY YHHNHALQSL MAAHQLQQLH IHSQHQQQML PQQHELQPQQ QPPSTELKTR  360
ALASQSQESA PLQE
Functional Description ? help Back to Top
Source Description
UniProtPutative transcription factor with an activatory role.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009383435.10.0PREDICTED: probable transcription factor PosF21 isoform X2
SwissprotQ040881e-125POF21_ARATH; Probable transcription factor PosF21
TrEMBLM0RRQ20.0M0RRQ2_MUSAM; Uncharacterized protein
STRINGGSMUA_Achr11P12720_0010.0(Musa acuminata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP42693868
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G06070.11e-126bZIP family protein
Publications ? help Back to Top
  1. Duarte JM, et al.
    Expression pattern shifts following duplication indicative of subfunctionalization and neofunctionalization in regulatory genes of Arabidopsis.
    Mol. Biol. Evol., 2006. 23(2): p. 469-78
    [PMID:16280546]
  2. Xu C, et al.
    Control of auxin-induced callus formation by bZIP59-LBD complex in Arabidopsis regeneration.
    Nat Plants, 2018. 4(2): p. 108-115
    [PMID:29358751]