PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID GSMUA_Achr11P10790_001
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Zingiberales; Musaceae; Musa
Family Dof
Protein Properties Length: 296aa    MW: 32021 Da    PI: 7.1764
Description Dof family protein
Gene Model
Gene Model ID Type Source Coding Sequence
GSMUA_Achr11P10790_001genomeCIRADView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-Dof126.86.5e-402788263
                  zf-Dof  2 kekalkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknkksss 63
                            +e+alkcprC stntkfCyynnyslsqPryfCk+CrryWt+GG+lrnvPvGgg+rknk+sss
  GSMUA_Achr11P10790_001 27 PEQALKCPRCASTNTKFCYYNNYSLSQPRYFCKGCRRYWTQGGSLRNVPVGGGCRKNKRSSS 88
                            6899******************************************************9875 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
ProDomPD0074785.0E-281885IPR003851Zinc finger, Dof-type
PfamPF027011.6E-332985IPR003851Zinc finger, Dof-type
PROSITE profilePS5088429.2553185IPR003851Zinc finger, Dof-type
PROSITE patternPS0136103369IPR003851Zinc finger, Dof-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005730Cellular Componentnucleolus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 296 aa     Download sequence    Send to blast
MARHHVDGLL VCPKNQLEQE RRPRPHPEQA LKCPRCASTN TKFCYYNNYS LSQPRYFCKG  60
CRRYWTQGGS LRNVPVGGGC RKNKRSSSSF PSKMTQDLDL TATSSINPLP PTFVPPPLAS  120
DLTLAFSGLH KEPPTEHLGL ENHCQSFLLE HASTESLLTT LSTNNGFLDT LRSGSVDALN  180
PSGLNNPYYG FGVHGSVEVK VGVSVEDRLM FPVGGPGDAA ARTVTGQGSW KDMDEGEAKV  240
LMGLPWQVEG DGNMAVDSGR DWTGGASSWP GLMGSSLISA ARTDMSSTIG DAYAFF
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankHM3665465e-51HM366546.1 Prunus persica clone PpDOF1 Dof-type zinc finger domain-containing protein mRNA, complete cds.
GenBankHM3665475e-51HM366547.1 Prunus persica clone PpDOF2 Dof-type zinc finger domain-containing protein mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009383306.10.0PREDICTED: dof zinc finger protein DOF5.3-like isoform X1
TrEMBLM0RR590.0M0RR59_MUSAM; Uncharacterized protein
STRINGGSMUA_Achr11P10790_0010.0(Musa acuminata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP47043263
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G60200.13e-39TARGET OF MONOPTEROS 6