PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID GSMUA_Achr11P03130_001
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Zingiberales; Musaceae; Musa
Family TCP
Protein Properties Length: 318aa    MW: 32406.3 Da    PI: 4.8057
Description TCP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
GSMUA_Achr11P03130_001genomeCIRADView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1TCP116.63.2e-3669136673
                     TCP   6 drhskihTkvggRdRRvRlsaecaarfFdLqdeLGfdkdsktieWLlqqakpaikeltgtssssasec 73 
                             +r++++hTkv+gR+RR+R++a caar+F+L++eLG+++d++ti+WLl+ a+pai+++tgt++++a ++
  GSMUA_Achr11P03130_001  69 SRTKDRHTKVEGRGRRIRMPAACAARIFQLTRELGHKSDGETIQWLLEHAEPAIIAATGTGTIPAIAT 136
                             69**********************************************************99999444 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF036343.2E-3070139IPR005333Transcription factor, TCP
PROSITE profilePS5136927.47471125IPR017887Transcription factor TCP subgroup
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0008361Biological Processregulation of cell size
GO:0048364Biological Processroot development
GO:1900056Biological Processnegative regulation of leaf senescence
GO:0005634Cellular Componentnucleus
Sequence ? help Back to Top
Protein Sequence    Length: 318 aa     Download sequence    Send to blast
MESQKRDEED GRRKTAEGGG GGGVGGVLGG GAAVPPSGVL PVHRFIVPKP EPLEMLGMGA  60
FQIIRRPASR TKDRHTKVEG RGRRIRMPAA CAARIFQLTR ELGHKSDGET IQWLLEHAEP  120
AIIAATGTGT IPAIATSVGG TLKIPTEAPT SAPVTSTSTP AAADDTADPM LPVGGAITMS  180
SGLAPMGSGA QGLVPMWTLG GSAAGASVIP PGPLWVLPPP SSAAGPSSQS QVWTFPQAPQ  240
IIHLAAVRPA STDTVFSSGV SGVNVATAAG AQPKAPAAGG KHELQLMSDP GTFQRGQARE  300
VDDDDEDEDD EDDSSAED
Functional Description ? help Back to Top
Source Description
UniProtTranscription activator. Binds the promoter core sequence 5'-GGNCC-3', especially at sites IIa (5'-GGGCCCAC-3') and IIb (5'-GGTCCCAC-3') (essential for meristematic tissue-specificity expression) of the PCNA gene promoter. {ECO:0000269|PubMed:12000681}.
UniProtTranscription activator. Binds the promoter core sequence 5'-GGNCC-3', especially at sites IIa (5'-GGGCCCAC-3') and IIb (5'-GGTCCCAC-3') (essential for meristematic tissue-specificity expression) of the PCNA gene promoter. {ECO:0000269|PubMed:12000681, ECO:0000269|PubMed:9338963}.
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00667PBMTransfer from GSVIVG01027588001Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009382279.10.0PREDICTED: transcription factor PCF2-like
SwissprotA2YXQ11e-56PCF2_ORYSI; Transcription factor PCF2
SwissprotQ6ZBH61e-56PCF2_ORYSJ; Transcription factor PCF2
TrEMBLM0RNZ30.0M0RNZ3_MUSAM; Uncharacterized protein
STRINGGSMUA_Achr11P03130_0010.0(Musa acuminata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP39123167
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G45680.11e-31TCP family protein
Publications ? help Back to Top
  1. Kikuchi S, et al.
    Collection, mapping, and annotation of over 28,000 cDNA clones from japonica rice.
    Science, 2003. 301(5631): p. 376-9
    [PMID:12869764]