PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID GSMUA_Achr10P27180_001
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Zingiberales; Musaceae; Musa
Family G2-like
Protein Properties Length: 399aa    MW: 43881.2 Da    PI: 6.0965
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
GSMUA_Achr10P27180_001genomeCIRADView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like101.74.8e-32197252156
                 G2-like   1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRla 56 
                             k+r++W+p+LH+rFv+a++ LGGs++AtPk+i+elmkv+gLt+++vkSHLQkYRl+
  GSMUA_Achr10P27180_001 197 KARRCWSPDLHRRFVNALQMLGGSQVATPKQIRELMKVDGLTNDEVKSHLQKYRLH 252
                             68****************************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129413.355194254IPR017930Myb domain
SuperFamilySSF466896.57E-17194255IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.602.2E-28195255IPR009057Homeodomain-like
TIGRFAMsTIGR015571.0E-26197252IPR006447Myb domain, plants
PfamPF002496.6E-7199250IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 399 aa     Download sequence    Send to blast
MGSPPELSLD YKLDNYTAVA KAAGAQPEQN QKIQEFLARL EEERHKIEVF KRELPLCMQL  60
LNNAIEIYKQ QLQERVPLKY MNVDGSDKAN WMVSAQLWSP PDDAAKQQAA PPPKEADVIP  120
KLALDTTKQR SGGAFLPFSR EKSRGAHATS AEKVVEEEKK CAELENEIVN TGRHSAADGH  180
GNTADGQAAA APPTHRKARR CWSPDLHRRF VNALQMLGGS QVATPKQIRE LMKVDGLTND  240
EVKSHLQKYR LHTRRPIPAP HAAAGAGAPP QLVVLGGIWV PPEYATSAGP AMYGAHAAPV  300
PREFYSPVPH HHYHHLHYPP LGLGASTPAA SRGRTADSPE PEVRSGGERS ESIEEEEEEV  360
RKRDEEEEEE EAPASEEKAL VPLMVKAEDD NGGDVVLKI
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
6j4k_A2e-14197250255Protein PHOSPHATE STARVATION RESPONSE 1
6j4k_B2e-14197250255Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_A2e-14197250154Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_B2e-14197250154Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_C2e-14197250154Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_D2e-14197250154Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_A2e-14197250255Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_C2e-14197250255Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_D2e-14197250255Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_F2e-14197250255Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_H2e-14197250255Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_J2e-14197250255Protein PHOSPHATE STARVATION RESPONSE 1
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor that may play a role in regulatory networks controlling development and metabolism. {ECO:0000250|UniProtKB:Q6Z869}.
UniProtTranscription factor acting as a flowering repressor, directly repressing FT expression in a dosage-dependent manner in the leaf vasculature. {ECO:0000269|PubMed:25132385}.
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: Up-regulated by SVP. Down-regulated by high temperature and gibberellic acid treatment. Not regulated by photoperiod, circadian rhythm under long days or vernalization. {ECO:0000269|PubMed:25132385}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009381136.20.0PREDICTED: myb family transcription factor EFM-like isoform X1
RefseqXP_018675067.10.0PREDICTED: myb family transcription factor EFM-like isoform X1
SwissprotQ5VRW21e-87NOH1_ORYSJ; Transcription factor NIGTH1
SwissprotQ9ZQ852e-88EFM_ARATH; Myb family transcription factor EFM
TrEMBLM0RLU20.0M0RLU2_MUSAM; Uncharacterized protein
STRINGGSMUA_Achr10P27180_0010.0(Musa acuminata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP97733338
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G03500.12e-77G2-like family protein
Publications ? help Back to Top
  1. Ding Y, et al.
    Four distinct types of dehydration stress memory genes in Arabidopsis thaliana.
    BMC Plant Biol., 2013. 13: p. 229
    [PMID:24377444]
  2. Kamrul Huda KM, et al.
    Salinity and drought tolerant OsACA6 enhances cold tolerance in transgenic tobacco by interacting with stress-inducible proteins.
    Plant Physiol. Biochem., 2014. 82: p. 229-38
    [PMID:24992889]