PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID GSMUA_Achr10P26120_001
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Zingiberales; Musaceae; Musa
Family VOZ
Protein Properties Length: 768aa    MW: 87003.9 Da    PI: 7.7636
Description VOZ family protein
Gene Model
Gene Model ID Type Source Coding Sequence
GSMUA_Achr10P26120_001genomeCIRADView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1VOZ438.77.7e-1354786941217
                     VOZ   1 pppsaflgpkcalwdctrpaqgsewlqdycssfhatlalneglpgttpvlrpkgidlkdgllfaalsakvqgkevgipecegaatak 87 
                             pppsafl+pkcalwdc+rpa+gsew++dycssfhatlalneg+pg+tpvlrp+gidlkdg+lfaal ak++gk+vgipecegaat+k
  GSMUA_Achr10P26120_001 478 PPPSAFLRPKCALWDCPRPARGSEWFEDYCSSFHATLALNEGPPGMTPVLRPGGIDLKDGPLFAALIAKTHGKNVGIPECEGAATNK 564
                             89************************************************************************************* PP

                     VOZ  88 spwnaaelfdlsllegetirewlffdkprrafesgnrkqrslpdysgrgwhesrkqvmkefgglkrsyymdpqpsssfewhlyeyei 174
                             spwna+elfdl +l+ge++rewlffdkprrafesgnrkqrslpdysgrgwhesrkqvmkefgglkrsyymdpqp+ ++ewhlyeyei
  GSMUA_Achr10P26120_001 565 SPWNAPELFDLLVLNGESVREWLFFDKPRRAFESGNRKQRSLPDYSGRGWHESRKQVMKEFGGLKRSYYMDPQPLRHYEWHLYEYEI 651
                             *************************************************************************************** PP

                     VOZ 175 neldalalyrlelklvdekksakgkvskdsladlqkklgrlta 217
                             n++da+alyrlelklvd kks kgkv++dsl+dlq+++grl+a
  GSMUA_Achr10P26120_001 652 NNCDACALYRLELKLVDPKKSIKGKVTSDSLVDLQQQMGRLNA 694
                             ****************************************986 PP

Sequence ? help Back to Top
Protein Sequence    Length: 768 aa     Download sequence    Send to blast
MMCGDWPKKV PLRLSWCDGW CGLLDHGGLM CSIICPTELL EACRGPFPAI YLLVTSLLSC  60
KQERDNNNND NNTNKEEEDK LYFSRKKKTS LLTISARRIR HFYRSEGMRK RSGGVGGAVL  120
HHHHRRWALR EKAKNRVNDL QGMFADVQSA HKEGRSADAA VLEEQLHQLL REWKAELGEP  180
SPAASAASSL PKGNSRGPSD LSSYIRRMLQ LNEEDDDATS KLAEPPLTSA NPKDEPLDVL  240
GPDVGELQSG GVAVFQCILR TYLRDWLRVD FRRSFPTSFL ITRVRKLLMG KPFVIIQIII  300
SLLLGVMTLC SFFLLVTCTC ETSAACHRSA PSIVTFLLHL KTFQNLTKYI ILNDFHVLLC  360
YLFSLIVPLV LICFIFNIFG QFSGFLSSCS LRRLNLKEHL IYEMPDYVFL GTQQFKCGSI  420
EAQRAALHCL EEANNLEFHH YNPHQELPQS VFLGFNAGGF DVGDLTPFLS EFIPAICPPP  480
SAFLRPKCAL WDCPRPARGS EWFEDYCSSF HATLALNEGP PGMTPVLRPG GIDLKDGPLF  540
AALIAKTHGK NVGIPECEGA ATNKSPWNAP ELFDLLVLNG ESVREWLFFD KPRRAFESGN  600
RKQRSLPDYS GRGWHESRKQ VMKEFGGLKR SYYMDPQPLR HYEWHLYEYE INNCDACALY  660
RLELKLVDPK KSIKGKVTSD SLVDLQQQMG RLNAENTMDS KRYAKGRPRF QYKDSAETMY  720
SALDFINQME NGESLHSSLD QKALVCDGVV YMRRFQTPVD DLNGYYGT
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009381028.10.0PREDICTED: transcription factor VOZ1
SwissprotQ9SGQ01e-140VOZ1_ARATH; Transcription factor VOZ1
TrEMBLM0RLI60.0M0RLI6_MUSAM; Uncharacterized protein
STRINGGSMUA_Achr10P26120_0010.0(Musa acuminata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP23433888
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G28520.21e-142vascular plant one zinc finger protein