PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID GSMUA_Achr10P10690_001
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Zingiberales; Musaceae; Musa
Family NAC
Protein Properties Length: 327aa    MW: 37252.4 Da    PI: 8.7188
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
GSMUA_Achr10P10690_001genomeCIRADView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM154.45e-48171432128
                     NAM   2 ppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratksgyWkatgk 88 
                             +pGfrFhPt+eel  +yL++kvegk++++ e i+ +d+y+++Pw+Lp+ ++ +ekew+f+++rd+ky++g+r+nr+t+sgyWkatg 
  GSMUA_Achr10P10690_001  17 MPGFRFHPTEEELFEFYLRRKVEGKRFNV-ELIPFLDLYRYDPWELPALAAIGEKEWFFYVPRDRKYRNGDRPNRVTRSGYWKATGA 102
                             79***************************.89***************8778899********************************* PP

                     NAM  89 dkevlsk.kgelvglkktLvfykgrapkgektdWvmheyrl 128
                             d+ +  + ++  +glkktLvfy+g+apkg +t+W+m+eyrl
  GSMUA_Achr10P10690_001 103 DRIIRGEnHRGSIGLKKTLVFYSGKAPKGIRTSWIMNEYRL 143
                             ****98766778***************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019414.05E-5416163IPR003441NAC domain
PROSITE profilePS5100554.30916164IPR003441NAC domain
PfamPF023651.6E-2418143IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 327 aa     Download sequence    Send to blast
MSGDDDGKDG HEHDLVMPGF RFHPTEEELF EFYLRRKVEG KRFNVELIPF LDLYRYDPWE  60
LPALAAIGEK EWFFYVPRDR KYRNGDRPNR VTRSGYWKAT GADRIIRGEN HRGSIGLKKT  120
LVFYSGKAPK GIRTSWIMNE YRLPHGETVQ CLRTEISLCR VYKRTGVVDH LQLPGPLASR  180
PSSSRGTAKL SCPRRQLPGV DPSLTLVMEK VPMLQGATPT NLSSPILSTV STASMEEDSA  240
PLHHSKNSLL SSTNYSMITP EIEELNRFVS YDHSFMSPPN TLSVTVPPQP QLAPLNQHTM  300
SLSMISDKLW EWWNPLPEIG KDYSGFK
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ut4_A1e-531816419165NO APICAL MERISTEM PROTEIN
1ut4_B1e-531816419165NO APICAL MERISTEM PROTEIN
1ut7_A1e-531816419165NO APICAL MERISTEM PROTEIN
1ut7_B1e-531816419165NO APICAL MERISTEM PROTEIN
3swm_A1e-531816422168NAC domain-containing protein 19
3swm_B1e-531816422168NAC domain-containing protein 19
3swm_C1e-531816422168NAC domain-containing protein 19
3swm_D1e-531816422168NAC domain-containing protein 19
3swp_A1e-531816422168NAC domain-containing protein 19
3swp_B1e-531816422168NAC domain-containing protein 19
3swp_C1e-531816422168NAC domain-containing protein 19
3swp_D1e-531816422168NAC domain-containing protein 19
4dul_A1e-531816419165NAC domain-containing protein 19
4dul_B1e-531816419165NAC domain-containing protein 19
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtTranscription factor that acts as a floral repressor. Controls flowering time by negatively regulating CONSTANS (CO) expression in a GIGANTEA (GI)-independent manner. Regulates the plant cold response by positive regulation of the cold response genes COR15A and KIN1. May coordinate cold response and flowering time. {ECO:0000269|PubMed:17653269}.
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: Circadian regulation with a peak of expression at dawn under continuous light conditions (PubMed:17653269). Circadian regulation with a peak of expression around dusk and lowest expression around dawn under continuous light conditions (at protein level) (PubMed:17653269). {ECO:0000269|PubMed:17653269}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009420478.10.0PREDICTED: NAC domain-containing protein 35-like
SwissprotQ9ZVP81e-95NAC35_ARATH; NAC domain-containing protein 35
TrEMBLM0RH450.0M0RH45_MUSAM; Uncharacterized protein
STRINGGSMUA_Achr10P10690_0010.0(Musa acuminata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP28263787
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G02450.11e-99NAC domain containing protein 35
Publications ? help Back to Top
  1. Ding Y, et al.
    Four distinct types of dehydration stress memory genes in Arabidopsis thaliana.
    BMC Plant Biol., 2013. 13: p. 229
    [PMID:24377444]
  2. Okajima K
    Molecular mechanism of phototropin light signaling.
    J. Plant Res., 2016. 129(2): p. 149-57
    [PMID:26815763]
  3. Nakasone Y,Ohshima M,Okajima K,Tokutomi S,Terazima M
    Photoreaction Dynamics of LOV1 and LOV2 of Phototropin from Chlamydomonas reinhardtii.
    J Phys Chem B, 2018. 122(6): p. 1801-1815
    [PMID:29355019]