PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID GSMUA_Achr10P03030_001
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Zingiberales; Musaceae; Musa
Family Dof
Protein Properties Length: 272aa    MW: 29112.3 Da    PI: 8.2034
Description Dof family protein
Gene Model
Gene Model ID Type Source Coding Sequence
GSMUA_Achr10P03030_001genomeCIRADView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-Dof1275.7e-403091263
                  zf-Dof  2 kekalkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknkksss 63
                            +e+alkcprC stntkfCyynnyslsqPryfCk+CrryWt+GG+lrnvPvGgg+rknk+sss
  GSMUA_Achr10P03030_001 30 PEQALKCPRCASTNTKFCYYNNYSLSQPRYFCKGCRRYWTQGGSLRNVPVGGGCRKNKRSSS 91
                            6899******************************************************9875 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
ProDomPD0074782.0E-262184IPR003851Zinc finger, Dof-type
PfamPF027011.4E-333288IPR003851Zinc finger, Dof-type
PROSITE profilePS5088429.2553488IPR003851Zinc finger, Dof-type
PROSITE patternPS0136103672IPR003851Zinc finger, Dof-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 272 aa     Download sequence    Send to blast
MLIASSVQPQ AMASHGLTQQ QQDRKLTPHP EQALKCPRCA STNTKFCYYN NYSLSQPRYF  60
CKGCRRYWTQ GGSLRNVPVG GGCRKNKRSS SSSSTSPSSK KSQEQDLTST HSNPLLPTLI  120
PPPLSYDPTD LTFSFTGLPK HPLAKQFGLE DNNHDADPMP SAPTPTNGGF LDILRTGFVD  180
ITSPSGLSNN LYYSYGIHGG LEMATGVSRE EGGLSGATAS ATTSQGSCKA MDGGDNKVRT  240
GLPWQDGNMD ASKDCWDGFG SSLQGLINSS GL
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_018674366.10.0PREDICTED: dof zinc finger protein DOF2.1 isoform X1
TrEMBLM0REY00.0M0REY0_MUSAM; Uncharacterized protein
STRINGGSMUA_Achr10P03030_0010.0(Musa acuminata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP47043263
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G24060.12e-32Dof family protein