PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Lus10043402
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Linaceae; Linum
Family NAC
Protein Properties Length: 332aa    MW: 36560.7 Da    PI: 5.1582
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Lus10043402genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM155.81.8e-48251511128
          NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLp.kkvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdkevlskkg 97 
                  + pGfrF+Ptd el+++yL+kk++g++  + evi++v+ +k+ePwdLp k+v ++e+ew+fFs+r +ky++g++++rat+ gyWkatgk+++v s ++
  Lus10043402  25 MFPGFRFSPTDVELISYYLHKKIDGHDKCV-EVIPQVEFCKHEPWDLPaKSVIKSETEWFFFSSRGRKYPNGSQSKRATELGYWKATGKERNVRS-GS 120
                  579************************777.99***************666667889*************************************9.99 PP

          NAM  98 elvglkktLvfykgrapkgektdWvmheyrl 128
                  +++g+k+tLvf+ grapkge+t+W+mhey++
  Lus10043402 121 SVIGTKRTLVFHLGRAPKGERTEWIMHEYSM 151
                  9****************************86 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019411.02E-5216166IPR003441NAC domain
PROSITE profilePS5100550.94225168IPR003441NAC domain
PfamPF023651.7E-2427150IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 332 aa     Download sequence    Send to blast
MGSTNYVDGG GVSRETQMSI EASSMFPGFR FSPTDVELIS YYLHKKIDGH DKCVEVIPQV  60
EFCKHEPWDL PAKSVIKSET EWFFFSSRGR KYPNGSQSKR ATELGYWKAT GKERNVRSGS  120
SVIGTKRTLV FHLGRAPKGE RTEWIMHEYS MPPSFNHESL VVCRLKKNVD FRGNQSCNGF  180
AEETAERRIM ETYAAECSAK KASSSSASYS NEQMDSVSND SENKLSNNSA TPAAAESSSR  240
HDTGLMDDLC HQGFGFSGRE DDYYADILND DIIKLDETCL ATAAAIPVSR APTADVPETA  300
VADGEAISGE EKELPLWLMS QQVGLAVSPR V*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3swm_A2e-402416819168NAC domain-containing protein 19
3swm_B2e-402416819168NAC domain-containing protein 19
3swm_C2e-402416819168NAC domain-containing protein 19
3swm_D2e-402416819168NAC domain-containing protein 19
3swp_A2e-402416819168NAC domain-containing protein 19
3swp_B2e-402416819168NAC domain-containing protein 19
3swp_C2e-402416819168NAC domain-containing protein 19
3swp_D2e-402416819168NAC domain-containing protein 19
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtTranscriptional activator activated by proteolytic cleavage through regulated intramembrane proteolysis (RIP), probably via metalloprotease activity. Regulates gibberellic acid-mediated salt-responsive repression of seed germination and flowering via FT, thus delaying seed germination under high salinity conditions. {ECO:0000269|PubMed:17410378, ECO:0000269|PubMed:18363782, ECO:0000269|PubMed:19704528, ECO:0000269|PubMed:19704545}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapLus10043402
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: By high salt stress (PubMed:19704545, PubMed:17410378, PubMed:18363782, PubMed:19704528). Repressed by gibberellic acid (GA), but induced by the GA biosynthetic inhibitor paclabutrazol (PAC) (PubMed:18363782). Accumulates transiently in seeds upon imbibition (PubMed:19704545, PubMed:17410378, PubMed:18363782, PubMed:19704528). Induced by drought stress (PubMed:17158162). {ECO:0000269|PubMed:17158162, ECO:0000269|PubMed:17410378, ECO:0000269|PubMed:18363782, ECO:0000269|PubMed:19704528, ECO:0000269|PubMed:19704545}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_021609917.11e-113NAC domain-containing protein 89
RefseqXP_021609918.11e-113NAC domain-containing protein 89
RefseqXP_021609919.11e-113NAC domain-containing protein 89
SwissprotQ9XIN75e-85NAC40_ARATH; NAC domain-containing protein 40
TrEMBLA0A0M5JKF01e-111A0A0M5JKF0_MANES; NAC transcription factors 92
STRINGLus100434020.0(Linum usitatissimum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF73153346
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G27300.11e-86NTM1-like 8
Publications ? help Back to Top
  1. Liang M, et al.
    Subcellular Distribution of NTL Transcription Factors in Arabidopsis thaliana.
    Traffic, 2015. 16(10): p. 1062-74
    [PMID:26201836]
  2. Tian H, et al.
    NTL8 Regulates Trichome Formation in Arabidopsis by Directly Activating R3 MYB Genes TRY and TCL1.
    Plant Physiol., 2017. 174(4): p. 2363-2375
    [PMID:28649093]