PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Lus10042882
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Linaceae; Linum
Family SBP
Protein Properties Length: 348aa    MW: 38181.6 Da    PI: 7.6882
Description SBP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Lus10042882genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SBP126.79e-40177254178
                  --SSTT-----TT--HHHHHTT--HHHHT-S-EEETTEEEEE-TTTSSEEETTT--SS--S-STTTT-------S--- CS
          SBP   1 lCqvegCeadlseakeyhrrhkvCevhskapvvlvsgleqrfCqqCsrfhelsefDeekrsCrrrLakhnerrrkkqa 78 
                  +Cq+egC+adl++ak+yhrrhkvCe+hska+++l++gl+qrfCqqCsrfh lsefD++krsCr+rLa+hn+r rk+++
  Lus10042882 177 RCQAEGCTADLTHAKHYHRRHKVCEFHSKASTILAAGLTQRFCQQCSRFHLLSEFDNGKRSCRKRLADHNRRGRKSNQ 254
                  6**************************************************************************986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:4.10.1100.101.2E-34173239IPR004333Transcription factor, SBP-box
PROSITE profilePS5114131.385175252IPR004333Transcription factor, SBP-box
SuperFamilySSF1036123.66E-37176256IPR004333Transcription factor, SBP-box
PfamPF031101.1E-29178251IPR004333Transcription factor, SBP-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 348 aa     Download sequence    Send to blast
MLEYEWAAAA NHLISGSDEP NQQESPDQSR QIFHHYSNAA ATEAYHHSFT DHNSLLPPQP  60
PSASLFHHQS NSFFDPRGAT TYAAGYATPT HNPSLLSLDH PSENPYFLVP KSEDDGMVMS  120
GASARSSSDF SSRIGLNLGG RTYFSSTEDD FVSRLYRRSR STLHEHGGGA MMTNAPRCQA  180
EGCTADLTHA KHYHRRHKVC EFHSKASTIL AAGLTQRFCQ QCSRFHLLSE FDNGKRSCRK  240
RLADHNRRGR KSNQNNTNSN QSHETLKAPA AAVGETGWNN NNNNNSPSDN LTERSPSESG  300
VQSCSSVTVA VSPPRMFLDC FKQRPYDQAT ASSSSSASSS SLFFLSG*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ul4_A4e-301782511184squamosa promoter binding protein-like 4
Search in ModeBase
Cis-element ? help Back to Top
SourceLink
PlantRegMapLus10042882
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012083646.11e-114squamosa promoter-binding-like protein 8
TrEMBLA0A067JXX71e-113A0A067JXX7_JATCU; Uncharacterized protein
STRINGLus100428820.0(Linum usitatissimum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF68013348
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G02065.11e-66squamosa promoter binding protein-like 8