PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Lus10042731
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Linaceae; Linum
Family NAC
Protein Properties Length: 297aa    MW: 33482 Da    PI: 7.9629
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Lus10042731genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM164.34.4e-5151291128
          NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdkevlskkge 98 
                  lppGfrFhPtd+elv++yL++k++++++++  +i+e+d+yk++PwdLp  +  +ekewyfFs+rd+ky++g+r+nr++++gyWkatg dk++ s   +
  Lus10042731   5 LPPGFRFHPTDDELVKHYLCRKCASQPISV-PIIAEIDLYKHDPWDLPGLALYGEKEWYFFSPRDRKYPNGSRPNRSAATGYWKATGADKSIGS--PR 99 
                  79****************************.88***************6555679*********************99**************99..77 PP

          NAM  99 lvglkktLvfykgrapkgektdWvmheyrl 128
                   + +kk Lvfy+g+apkgekt+W+mheyrl
  Lus10042731 100 PIAIKKALVFYTGKAPKGEKTNWIMHEYRL 129
                  9***************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019415.1E-603156IPR003441NAC domain
PROSITE profilePS5100559.1715156IPR003441NAC domain
PfamPF023654.3E-276129IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009611Biological Processresponse to wounding
GO:0009788Biological Processnegative regulation of abscisic acid-activated signaling pathway
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 297 aa     Download sequence    Send to blast
MVLELPPGFR FHPTDDELVK HYLCRKCASQ PISVPIIAEI DLYKHDPWDL PGLALYGEKE  60
WYFFSPRDRK YPNGSRPNRS AATGYWKATG ADKSIGSPRP IAIKKALVFY TGKAPKGEKT  120
NWIMHEYRLA DVDRSAARKK NSLRLDDWVL CRIYNKKGAA VDRRTAGIRR AVSPETMEDI  180
KPSVMAPPPP QLPTGGHQTN PANSGHTYLE TSESVPRLLT DSSCSEQVFS PEFTTSEVQS  240
EPKWKELGAG MNDLDFGFNY MDATMEKEFG SQFQFPGSSN QMSPLQDMFM YLQQPF*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3ulx_A6e-77315713169Stress-induced transcription factor NAC1
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00121DAPTransfer from AT1G01720Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMapLus10042731
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankHQ8879031e-116HQ887903.1 Linum usitatissimum clone GMU2AYZ01A2204 microsatellite sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015575373.11e-152NAC domain-containing protein 2
SwissprotQ390131e-146NAC2_ARATH; NAC domain-containing protein 2
TrEMBLB9S2X21e-150B9S2X2_RICCO; NAC domain-containing protein, putative
STRINGLus100427310.0(Linum usitatissimum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF125834108
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G01720.11e-148NAC family protein
Publications ? help Back to Top
  1. Florentin A,Damri M,Grafi G
    Stress induces plant somatic cells to acquire some features of stem cells accompanied by selective chromatin reorganization.
    Dev. Dyn., 2013. 242(10): p. 1121-33
    [PMID:23798027]
  2. Jensen MK, et al.
    ATAF1 transcription factor directly regulates abscisic acid biosynthetic gene NCED3 in Arabidopsis thaliana.
    FEBS Open Bio, 2013. 3: p. 321-7
    [PMID:23951554]
  3. Wang YX
    Characterization of a novel Medicago sativa NAC transcription factor gene involved in response to drought stress.
    Mol. Biol. Rep., 2013. 40(11): p. 6451-8
    [PMID:24057250]
  4. Yang X, et al.
    Overexpression of a Miscanthus lutarioriparius NAC gene MlNAC5 confers enhanced drought and cold tolerance in Arabidopsis.
    Plant Cell Rep., 2015. 34(6): p. 943-58
    [PMID:25666276]
  5. Du Q,Wang H
    The role of HD-ZIP III transcription factors and miR165/166 in vascular development and secondary cell wall formation.
    Plant Signal Behav, 2015. 10(10): p. e1078955
    [PMID:26340415]
  6. Takasaki H, et al.
    SNAC-As, stress-responsive NAC transcription factors, mediate ABA-inducible leaf senescence.
    Plant J., 2015. 84(6): p. 1114-23
    [PMID:26518251]
  7. Liu Y,Sun J,Wu Y
    Arabidopsis ATAF1 enhances the tolerance to salt stress and ABA in transgenic rice.
    J. Plant Res., 2016. 129(5): p. 955-962
    [PMID:27216423]
  8. Ghandchi FP,Caetano-Anolles G,Clough SJ,Ort DR
    Investigating the Control of Chlorophyll Degradation by Genomic Correlation Mining.
    PLoS ONE, 2016. 11(9): p. e0162327
    [PMID:27618630]
  9. Zhao J,Missihoun TD,Bartels D
    The ATAF1 transcription factor is a key regulator of aldehyde dehydrogenase 7B4 (ALDH7B4) gene expression in Arabidopsis thaliana.
    Planta, 2018. 248(4): p. 1017-1027
    [PMID:30027414]