PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Lus10042284
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Linaceae; Linum
Family NAC
Protein Properties Length: 300aa    MW: 34373.9 Da    PI: 5.2236
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Lus10042284genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM176.48.2e-5561331128
          NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLp.k.kvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdkevlskk 96 
                  lppGfrFhPtdeelv++yLk+k++g+++el ++i+evd+yk+ePw+L  k  + +++ ewyfF +rd+ky++g r+nrat++gyWk+tgkd++v+s +
  Lus10042284   6 LPPGFRFHPTDEELVNYYLKRKINGQEIEL-DIIPEVDLYKCEPWELSeKsFLPSKDPEWYFFGPRDRKYPNGFRTNRATRAGYWKSTGKDRRVVS-Q 101
                  79****************************.99**************84335556788**************************************.9 PP

          NAM  97 gelvglkktLvfykgrapkgektdWvmheyrl 128
                  ++++g+kktLv+y+grap+g +tdWvmheyr+
  Lus10042284 102 TRVIGMKKTLVYYRGRAPQGLRTDWVMHEYRV 133
                  99****************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019415.36E-644156IPR003441NAC domain
PROSITE profilePS5100560.1616156IPR003441NAC domain
PfamPF023653.6E-307133IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 300 aa     Download sequence    Send to blast
MSPVGLPPGF RFHPTDEELV NYYLKRKING QEIELDIIPE VDLYKCEPWE LSEKSFLPSK  60
DPEWYFFGPR DRKYPNGFRT NRATRAGYWK STGKDRRVVS QTRVIGMKKT LVYYRGRAPQ  120
GLRTDWVMHE YRVDDKDCED TSGLQDSYAL CRVFKKNGIC TETAEQEIQQ SFVYGGATSS  180
SAARRNRTSP AAIMETSPDA AMNHDINHLM IDQYNNYDST MSPDVPVNAS SSSCLEDEEK  240
DVDDNSWMQF ITDDDPWSSS SMVNGGDDVT YQQQQPQVHH NHHQQHHRQV SANTSTFTD*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3ulx_A6e-54415713169Stress-induced transcription factor NAC1
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtTranscription factor directing sieve element enucleation and cytosol degradation. Not required for formation of lytic vacuoles. Regulates, with NAC045, the transcription of NEN1, NEN2, NEN3, NEN4, RTM1, RTM2, UBP16, PLDZETA, ABCB10 and At1g26450. {ECO:0000269|PubMed:25081480}.
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00363DAPTransfer from AT3G17730Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMapLus10042284
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006374257.11e-132NAC domain-containing protein 86 isoform X2
SwissprotQ9FFI53e-89NAC86_ARATH; NAC domain-containing protein 86
TrEMBLU5FPE31e-131U5FPE3_POPTR; Uncharacterized protein
STRINGLus100422840.0(Linum usitatissimum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF95643343
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G17730.11e-122NAC domain containing protein 57
Publications ? help Back to Top
  1. Duarte JM, et al.
    Expression pattern shifts following duplication indicative of subfunctionalization and neofunctionalization in regulatory genes of Arabidopsis.
    Mol. Biol. Evol., 2006. 23(2): p. 469-78
    [PMID:16280546]