PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Lus10041935
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Linaceae; Linum
Family SBP
Protein Properties Length: 222aa    MW: 24497.1 Da    PI: 10.1563
Description SBP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Lus10041935genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SBP68.61.2e-215098149
                 --SSTT-----TT--HHHHHTT--HHHHT-S-EEETTEEEEE-TTTSSE CS
          SBP  1 lCqvegCeadlseakeyhrrhkvCevhskapvvlvsgleqrfCqqCsrf 49
                 +Cqve+C a+lse k+yhrrhkvC++hsk+p+vlvsgl+qrfCqqCsr 
  Lus10041935 50 CCQVERCGANLSEGKQYHRRHKVCDFHSKCPSVLVSGLRQRFCQQCSRC 98
                 6**********************************************96 PP

2SBP38.92.4e-121281545278
                  TTT--SS--S-STTTT-------S--- CS
          SBP  52 lsefDeekrsCrrrLakhnerrrkkqa 78 
                  +sefDe+krsCrrrLa+hnerrrk+++
  Lus10041935 128 VSEFDEAKRSCRRRLAGHNERRRKSST 154
                  79**********************975 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:4.10.1100.101.5E-204698IPR004333Transcription factor, SBP-box
PROSITE profilePS5114123.53848152IPR004333Transcription factor, SBP-box
SuperFamilySSF1036121.57E-204999IPR004333Transcription factor, SBP-box
PfamPF031101.5E-155199IPR004333Transcription factor, SBP-box
SuperFamilySSF1036125.3E-9128155IPR004333Transcription factor, SBP-box
PfamPF031103.4E-6128151IPR004333Transcription factor, SBP-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 222 aa     Download sequence    Send to blast
MDFRTDSAGY TNDHQVVDDD EVEDQQQLQE LDISWKKGAA GPPRRASNLC CQVERCGANL  60
SEGKQYHRRH KVCDFHSKCP SVLVSGLRQR FCQQCSRCRS SMKRRGAAGG GGGGTTKGGG  120
RGRQRWGVSE FDEAKRSCRR RLAGHNERRR KSSTTMAEGI NCGEGSSNRK GVGGGGMSVQ  180
MQQHQCTNNS RQCDNNNNGG MRFQQVAATG NINYKRSQIR Y*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ul4_A1e-26511511184squamosa promoter binding protein-like 4
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtProbable transcriptional factor. Binds to the promoter of the SQUAMOSA gene.
Cis-element ? help Back to Top
SourceLink
PlantRegMapLus10041935
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
SwissprotQ387419e-32SBP1_ANTMA; Squamosa promoter-binding protein 1
STRINGLus100419351e-161(Linum usitatissimum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF53534153
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G33810.19e-24squamosa promoter binding protein-like 3
Publications ? help Back to Top
  1. Klein J,Saedler H,Huijser P
    A new family of DNA binding proteins includes putative transcriptional regulators of the Antirrhinum majus floral meristem identity gene SQUAMOSA.
    Mol. Gen. Genet., 1996. 250(1): p. 7-16
    [PMID:8569690]