PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Lus10041020
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Linaceae; Linum
Family ARR-B
Protein Properties Length: 650aa    MW: 71128.7 Da    PI: 6.8686
Description ARR-B family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Lus10041020genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like89.53.1e-28195248155
      G2-like   1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55 
                  kpr++W+ eLH++Fv+av++L G +kA+Pk+il+lm+v+ Lt+e+v+SHLQkYRl
  Lus10041020 195 KPRVVWSVELHRKFVSAVNHL-GVDKAVPKKILDLMNVEKLTRENVASHLQKYRL 248
                  79*******************.********************************8 PP

2Response_reg75.91.5e-25181261109
                   EEEESSSHHHHHHHHHHHHHTTCEEEEEESSHHHHHHHHHHHH..ESEEEEESSCTTSEHHHHHHHHHHHTTTSEEEEEESTTTHHHHHHHHHTTES CS
  Response_reg   1 vlivdDeplvrellrqalekegyeevaeaddgeealellkekd..pDlillDiempgmdGlellkeireeepklpiivvtahgeeedalealkaGak 95 
                   vl vdD+ + + +l+++l+k +y +v+++++++ al++l+e++  +Dl++ D+ mp+mdG++ll++   e  +lp+i+++a+++++ + + +  Ga 
   Lus10041020  18 VLAVDDDLTCLLVLETLLRKCQY-HVTTTSQARMALTMLRERRndFDLVISDVHMPDMDGFHLLEKVGLEM-DLPVIMLSANSDPKVVMKGITHGAC 112
                   799********************.***************888888**********************6644.8************************ PP

                   EEEESS--HHHHHH CS
  Response_reg  96 dflsKpfdpeelvk 109
                   d+l Kp+ +eel +
   Lus10041020 113 DYLLKPIRIEELKN 126
                   ***********987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF521726.97E-3515139IPR011006CheY-like superfamily
Gene3DG3DSA:3.40.50.23001.2E-4215154No hitNo description
SMARTSM004487.2E-3116128IPR001789Signal transduction response regulator, receiver domain
PROSITE profilePS5011042.15917132IPR001789Signal transduction response regulator, receiver domain
PfamPF000729.4E-2318126IPR001789Signal transduction response regulator, receiver domain
CDDcd001561.94E-2619131No hitNo description
Gene3DG3DSA:1.10.10.607.9E-30192253IPR009057Homeodomain-like
PROSITE profilePS5129412.093192251IPR017930Myb domain
SuperFamilySSF466891.97E-19193252IPR009057Homeodomain-like
TIGRFAMsTIGR015573.4E-25195248IPR006447Myb domain, plants
PfamPF002494.4E-7197247IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0000160Biological Processphosphorelay signal transduction system
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 650 aa     Download sequence    Send to blast
MIVEQGGSRD QFPIGMRVLA VDDDLTCLLV LETLLRKCQY HVTTTSQARM ALTMLRERRN  60
DFDLVISDVH MPDMDGFHLL EKVGLEMDLP VIMLSANSDP KVVMKGITHG ACDYLLKPIR  120
IEELKNIWQH VVRRKKTDNR DKNNSDNRDN KPNSQSGEAT SEQKLNKKRK DQIDEEDEDS  180
DDNGNDYDDP SSQKKPRVVW SVELHRKFVS AVNHLGVDKA VPKKILDLMN VEKLTRENVA  240
SHLQKYRLYL KRISTVANQQ ANMAAALVGS DASYLQMGPL TGLGLHNVAG NGQFQNGGFR  300
SVTPNGMLGR LNSPAGMSFH GLPSPGMMQV AHVQTGGHLT SQNQFQSVIS NANVLQGMPV  360
SLELDQIQPN KGINYMREIP TAIESTSGFA DTSMAVGSSN DSFVGASSDK SLFLDRRRLQ  420
GTQPDAKFSK QNSLMGSSLD QGFSLDPGRC NESWSNAAPS TGVQSNSLII NDSFRTGGLP  480
ASTIVRDNMS TMTMQARSRQ CEVSPLSTLP LHLQDEKADL GCRLASASSG GVGEIIGSWD  540
DHRQASPYYF NAASSSANSS IPDDVINQRW DANCNAMFQR NPSFGSTGQS SFIDSSLVKH  600
DGVAVEASRI SNGRTSMNQH NVQTGHNNFG SLEDVATGFM VTRVSSRIK*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1irz_A4e-27191254164ARR10-B
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtTranscriptional activator that binds specifically to the DNA sequence 5'-[AG]GATT-3'. Functions as a response regulator involved in His-to-Asp phosphorelay signal transduction system. Phosphorylation of the Asp residue in the receiver domain activates the ability of the protein to promote the transcription of target genes. Could directly activate some type-A response regulators in response to cytokinins. Involved in the root-meristem size determination through the regulation of cell differentiation (PubMed:17363254). Involved in activating SHY2 during meristem growth and controls PIN expression via activation of SHY2 (PubMed:20605455). {ECO:0000250|UniProtKB:Q940D0, ECO:0000269|PubMed:17363254, ECO:0000269|PubMed:20605455}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapLus10041020
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015572552.10.0two-component response regulator ARR12 isoform X1
RefseqXP_025012481.10.0two-component response regulator ARR12 isoform X2
SwissprotP625981e-135ARR12_ARATH; Two-component response regulator ARR12
TrEMBLB9RNX80.0B9RNX8_RICCO; Two-component response regulator
STRINGLus100410200.0(Linum usitatissimum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF95634112
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G25180.11e-115response regulator 12
Publications ? help Back to Top
  1. Takahashi N, et al.
    Cytokinins control endocycle onset by promoting the expression of an APC/C activator in Arabidopsis roots.
    Curr. Biol., 2013. 23(18): p. 1812-7
    [PMID:24035544]
  2. Cortleven A, et al.
    A novel protective function for cytokinin in the light stress response is mediated by the Arabidopsis histidine kinase2 and Arabidopsis histidine kinase3 receptors.
    Plant Physiol., 2014. 164(3): p. 1470-83
    [PMID:24424319]
  3. Kim HJ,Kieber JJ,Schaller GE
    The rice F-box protein KISS ME DEADLY2 functions as a negative regulator of cytokinin signalling.
    Plant Signal Behav, 2013. 8(12): p. e26434
    [PMID:24675172]
  4. Choi SH, et al.
    Gene duplication of type-B ARR transcription factors systematically extends transcriptional regulatory structures in Arabidopsis.
    Sci Rep, 2014. 4: p. 7197
    [PMID:25425016]
  5. Jiang L, et al.
    Strigolactones spatially influence lateral root development through the cytokinin signaling network.
    J. Exp. Bot., 2016. 67(1): p. 379-89
    [PMID:26519957]
  6. Cortleven A, et al.
    Cytokinin Regulates the Etioplast-Chloroplast Transition through the Two-Component Signaling System and Activation of Chloroplast-Related Genes.
    Plant Physiol., 2016. 172(1): p. 464-78
    [PMID:27388681]
  7. Kobayashi K, et al.
    Shoot Removal Induces Chloroplast Development in Roots via Cytokinin Signaling.
    Plant Physiol., 2017. 173(4): p. 2340-2355
    [PMID:28193764]
  8. Zhang TQ, et al.
    A Two-Step Model for de Novo Activation of WUSCHEL during Plant Shoot Regeneration.
    Plant Cell, 2017. 29(5): p. 1073-1087
    [PMID:28389585]
  9. Meng WJ, et al.
    Type-B ARABIDOPSIS RESPONSE REGULATORs Specify the Shoot Stem Cell Niche by Dual Regulation of WUSCHEL.
    Plant Cell, 2017. 29(6): p. 1357-1372
    [PMID:28576846]
  10. Kobayashi K,Iwase A
    Simultaneous but spatially different regulation of non-photosynthetic callus formation and photosynthetic root development after shoot removal.
    Plant Signal Behav, 2017. 12(6): p. e1338999
    [PMID:28594268]
  11. Dai X, et al.
    ARR12 promotes de novo shoot regeneration in Arabidopsis thaliana via activation of WUSCHEL expression.
    J Integr Plant Biol, 2017. 59(10): p. 747-758
    [PMID:28681564]
  12. Zhang F,May A,Irish VF
    Type-B ARABIDOPSIS RESPONSE REGULATORs Directly Activate WUSCHEL.
    Trends Plant Sci., 2017. 22(10): p. 815-817
    [PMID:28886911]
  13. Yan Z, et al.
    Type B Response Regulators Act As Central Integrators in Transcriptional Control of the Auxin Biosynthesis Enzyme TAA1.
    Plant Physiol., 2017. 175(3): p. 1438-1454
    [PMID:28931628]
  14. Bustillo-AvendaƱo E, et al.
    Regulation of Hormonal Control, Cell Reprogramming, and Patterning during De Novo Root Organogenesis.
    Plant Physiol., 2018. 176(2): p. 1709-1727
    [PMID:29233938]