PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Lus10040921
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Linaceae; Linum
Family HB-other
Protein Properties Length: 1148aa    MW: 125931 Da    PI: 7.2764
Description HB-other family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Lus10040921genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox21.34.5e-0769125157
                  TT--SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHHC CS
     Homeobox   1 rrkRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakekk 57 
                  +r+R  ++++ ++ ++++F  +  +s++e +e++++ ++t +qV+ +F  +R + ++
  Lus10040921  69 KRPRDLLNPKAIKYMQAVFSIKDAISKKESREISAQFSITVTQVREFFTSQRSRVRR 125
                  799**************************************************9987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5007110.10666126IPR001356Homeobox domain
SuperFamilySSF466895.56E-667128IPR009057Homeodomain-like
SMARTSM003892.3E-468130IPR001356Homeobox domain
PfamPF000461.8E-469125IPR001356Homeobox domain
Gene3DG3DSA:1.10.10.607.9E-669129IPR009057Homeodomain-like
CDDcd000860.0058869116No hitNo description
Gene3DG3DSA:1.20.930.102.7E-5293381IPR017923Transcription factor IIS, N-terminal
SuperFamilySSF476761.54E-5293384IPR017923Transcription factor IIS, N-terminal
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006351Biological Processtranscription, DNA-templated
GO:0009911Biological Processpositive regulation of flower development
GO:0010228Biological Processvegetative to reproductive phase transition of meristem
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 1148 aa     Download sequence    Send to blast
MAGLKEDFAE MEIGTTAASF QRFMDSQKDL FHSQVDQLQR IVVTQCKLTG VNPLSQEMAA  60
GALSINIGKR PRDLLNPKAI KYMQAVFSIK DAISKKESRE ISAQFSITVT QVREFFTSQR  120
SRVRRLVRLA REKGIQANSL KEPENNLQID GIPRGSNSVS LNLIVPDTVP ASSNGPTDVT  180
SSTACPYTAP LRSVGPNSVP LTAANLNPEI RTSVGSDYIP LNCITPDSEP LLSEGPANCE  240
GGQFFSKQEE ILPGLDDSEK HFVETIFGLL KREETFGGQV KLMEWVLQIQ NLTVLNWFLT  300
EGGVMILATW LTQAAAEEQT SVLLVALRVL CHLPLHNAFP EHMSAILHSV NTLRFYRTSD  360
ISSRARILLA KWTKLFARSQ SLRKPNGVGS SIDAQDMILK KSIDEIMSNG FSQTDIGYTE  420
GSLALPSGNS VNIRRMESSQ TMKLLPASSD DSSRKYILGS PSRFVYFFVS SLLIIWTSIE  480
MIHPDPIREL VADTRERRKV QLVEQPGQKP SSRSPQGAKS GSTSQGRPMS ADDIQKAKMR  540
ALYMQSKYGR KSNLSNGSNS MKNGIVDKMP PVSIGSSSQV SKVLAKLKNE EPKEPVIAAA  600
PTSICKGEHL DNTMLKVESQ VVSKARAEPT NEEPKERVIA AAPMSICKTE HPDTTMLKVE  660
STVFSKALAE PKDEEVKEPV ISTPKSTCKD EHQHATEQKV ASNMPVKQIC SRPQIRWHSP  720
TEVKLDVEWR VGTGEFSKEV EVQKNRNRRE METIYRAVNE IPSNPKEPWD LDMDYDDSLT  780
PEIPIEQQPD ADGTDTQIPD NQLENPVAAA PTMANGGVAA VAEPDLELLA VLLKNPALVF  840
ALTSGQAGNL SSDDTVRLLE MMKTGGIALG NSVNESDGKV GEVSLPSPTP SSNNPRTSGW  900
KPEVARNPFS QRNPLGNGGR AAGFVDTTTV TSSVHPENRV TTNMGFLPQK HSHEQYYHHQ  960
SFTDHPRIQT STSDSPSTSF VDRHHTRFQQ PSLSSATLLH QQTYMSNESS YLSRPVAGNV  1020
VNVGRGSPAA ASNDSWRVRQ GSVVASNSYS SNVVNQNLYN GTSTSYGGNQ SRAGHLQYGA  1080
AGFESWGPEN SHCNTDRSSS EQVVGRGLGG RRGSEWPDDN QRPTRHRNLA SSSGFQDHDS  1140
NNNRRWP*
Cis-element ? help Back to Top
SourceLink
PlantRegMapLus10040921
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
STRINGLus100409210.0(Linum usitatissimum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF98092934
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G02560.20.0HB-other family protein