PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Lus10040840
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Linaceae; Linum
Family WOX
Protein Properties Length: 279aa    MW: 30719 Da    PI: 8.6016
Description WOX family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Lus10040840genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox60.13.6e-192482457
                 -SS--HHHHHHHHHHHHH.SSS--HHHHHHHHHHC....TS-HHHHHHHHHHHHHHHHC CS
     Homeobox  4 RttftkeqleeLeelFek.nrypsaeereeLAkkl....gLterqVkvWFqNrRakekk 57
                 R+t+t+ q++ Le l+++  r+p+ ++++++A+ l    +++ ++V++WFqN++a++++
  Lus10040840 24 RWTPTSPQINLLEGLYNQgLRTPTPDQIQQIAAMLsthgHIEGKNVFYWFQNHKARQRQ 82
                 *****************99**************************************96 PP

2Wus_type_Homeobox1085.5e-352283364
  Wus_type_Homeobox  3 rtRWtPtpeQikiLeelyksGlrtPnkeeiqritaeLeeyGkiedkNVfyWFQNrkaRerqk 64
                       + RWtPt+ Qi++Le ly++GlrtP+ ++iq+i+a+L+++G+ie+kNVfyWFQN+kaR+rqk
        Lus10040840 22 NFRWTPTSPQINLLEGLYNQGLRTPTPDQIQQIAAMLSTHGHIEGKNVFYWFQNHKARQRQK 83
                       67***********************************************************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5007110.3171883IPR001356Homeobox domain
SMARTSM003892.9E-52087IPR001356Homeobox domain
SuperFamilySSF466894.23E-122386IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.601.5E-72482IPR009057Homeodomain-like
PfamPF000468.4E-172482IPR001356Homeobox domain
CDDcd000864.56E-62483No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 279 aa     Download sequence    Send to blast
MDTNNPAAAN KKNATSSRIP ANFRWTPTSP QINLLEGLYN QGLRTPTPDQ IQQIAAMLST  60
HGHIEGKNVF YWFQNHKARQ RQKLKQDVII NNNINHNNNL PFVNHHPHHH FLRKPPLPPP  120
SPHGVVRHVP SPSPGHCGTS SYNTSSQADL GMPRRPQEFR VVPAGGLTQI RSAEKISWRT  180
ATAAAHRIVP DTLNNNDGGT YNYDCDTDQE TLPLFPLHPT GGLLARSSTS SSSDNNLCSS  240
PSYSSCDTGV DVEDGDSGRR CFDFFSLGQG HLCPSQRY*
Cis-element ? help Back to Top
SourceLink
PlantRegMapLus10040840
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
STRINGLus100408400.0(Linum usitatissimum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF82563044
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G59340.16e-28WUSCHEL related homeobox 2