PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Lus10040595
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Linaceae; Linum
Family SBP
Protein Properties Length: 381aa    MW: 41117.9 Da    PI: 8.2869
Description SBP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Lus10040595genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SBP69.75.7e-22164214151
                  --SSTT-----TT--HHHHHTT--HHHHT-S-EEETTEEEEE-TTTSSEEE CS
          SBP   1 lCqvegCeadlseakeyhrrhkvCevhskapvvlvsgleqrfCqqCsrfhe 51 
                  +CqvegC+ dl++ak+yhrrh++Ce hsk+p+v+vsgle+rfCqqC    +
  Lus10040595 164 CCQVEGCNLDLKSAKDYHRRHRICESHSKSPKVVVSGLERRFCQQCNNRRQ 214
                  6*********************************************87655 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS512575117No hitNo description
Gene3DG3DSA:4.10.1100.108.6E-23158211IPR004333Transcription factor, SBP-box
PROSITE profilePS5114118.743162239IPR004333Transcription factor, SBP-box
SuperFamilySSF1036126.28E-22163216IPR004333Transcription factor, SBP-box
PfamPF031104.1E-18165215IPR004333Transcription factor, SBP-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 381 aa     Download sequence    Send to blast
MSHSGRAAIA SPSLTSCVAM DWNLKSASEW DWDNLYGFSS RTCGTQKQQV KHLNPEAEGE  60
GVGRIDSGLI YSHGCAGGFS GSDSGYGSSS KSSVSASVGS SSKDGLQTLN TVEGHSNVDK  120
VSSGEHVIGL KLGRRTYFGD VCTTKSVVAV KRPRSSCQSV QSPCCQVEGC NLDLKSAKDY  180
HRRHRICESH SKSPKVVVSG LERRFCQQCN NRRQMNRVAL RAKSFTWPSG CSLDSLPKIM  240
KSKGMSRQMS NLSINDVHEE MISDKGLSFK SSTSQIFSEG LECSSSTCNL EMNPNFGGAL  300
SLLSTTSSWG LNEPTALEQM TLVKNTSMAH QTMIHAAEPQ SWSLSPSAAN AFDGNITTLQ  360
QFHQCKTPYQ PGSFYSNPTD *
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1wj0_A3e-14164210551squamosa promoter-binding protein-like 12
Cis-element ? help Back to Top
SourceLink
PlantRegMapLus10040595
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankHQ8885778e-72HQ888577.1 Linum usitatissimum clone GMU2AYZ01AS0MU microsatellite sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_023874058.13e-66LOW QUALITY PROTEIN: squamosa promoter-binding-like protein 3
TrEMBLA0A2I6SET72e-74A0A2I6SET7_9ROSI; SBP-box transcription factor
STRINGLus100405950.0(Linum usitatissimum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF46303058
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G43270.31e-17squamosa promoter binding protein-like 2