PlantTFDB
Plant Transcription Factor Database
v5.0
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Lus10040313
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Linaceae; Linum
Family LBD
Protein Properties Length: 154aa    MW: 17595.3 Da    PI: 6.0054
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Lus10040313genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF260122.81.7e-387103197
       DUF260   1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqqleqlkaelall 97 
                  +Ca+Ck+lrr+Ca+dCvlapyfp ++p++f++vhk+FGasn+ +ll+++p e r +a++++ +eA ar+r+PvyG+vg+i++lqq++ +++ e++ +
  Lus10040313   7 RCAGCKYLRRRCAQDCVLAPYFPPDNPQRFEFVHKIFGASNLARLLQEVPVESRGKAADCMSFEASARVREPVYGCVGMIHELQQEILKVQLEVENI 103
                  6***************************************************************************************999998765 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089124.5386107IPR004883Lateral organ boundaries, LOB
PfamPF031952.9E-387102IPR004883Lateral organ boundaries, LOB
Sequence ? help Back to Top
Protein Sequence    Length: 154 aa     Download sequence    Send to blast
MSSIGRRCAG CKYLRRRCAQ DCVLAPYFPP DNPQRFEFVH KIFGASNLAR LLQEVPVESR  60
GKAADCMSFE ASARVREPVY GCVGMIHELQ QEILKVQLEV ENIEGMLALH RAEHQLLVMR  120
QQEEKKNMLP DYVDFGAHCN LDLEDDQFLW PLT*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5ly0_A8e-3451019105LOB family transfactor Ramosa2.1
5ly0_B8e-3451019105LOB family transfactor Ramosa2.1
Search in ModeBase
Cis-element ? help Back to Top
SourceLink
PlantRegMapLus10040313
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002316444.35e-48LOB domain-containing protein 24
SwissprotQ8LBW39e-39LBD12_ARATH; LOB domain-containing protein 12
TrEMBLA0A2K1YZY88e-47A0A2K1YZY8_POPTR; Uncharacterized protein (Fragment)
STRINGLus100403131e-111(Linum usitatissimum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF36973066
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G30130.14e-41LBD family protein
Publications ? help Back to Top
  1. Penfield S, et al.
    Reserve mobilization in the Arabidopsis endosperm fuels hypocotyl elongation in the dark, is independent of abscisic acid, and requires PHOSPHOENOLPYRUVATE CARBOXYKINASE1.
    Plant Cell, 2004. 16(10): p. 2705-18
    [PMID:15367715]