PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Lus10039846
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Linaceae; Linum
Family SBP
Protein Properties Length: 204aa    MW: 23007.6 Da    PI: 8.4935
Description SBP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Lus10039846genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SBP129.71e-4079155177
                  --SSTT-----TT--HHHHHTT--HHHHT-S-EEETTEEEEE-TTTSSEEETTT--SS--S-STTTT-------S-- CS
          SBP   1 lCqvegCeadlseakeyhrrhkvCevhskapvvlvsgleqrfCqqCsrfhelsefDeekrsCrrrLakhnerrrkkq 77 
                  +Cq+e+C++dl+ ak yhrrh+vCe hska+vvlvsgl+qrfCqqCsrfhel efD+ krsCrrrLa+hnerrrk++
  Lus10039846  79 CCQAEKCTNDLTVAKAYHRRHRVCEYHSKAQVVLVSGLRQRFCQQCSRFHELPEFDDMKRSCRRRLAGHNERRRKNA 155
                  6**************************************************************************87 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:4.10.1100.102.4E-3176141IPR004333Transcription factor, SBP-box
PROSITE profilePS5114131.34277154IPR004333Transcription factor, SBP-box
SuperFamilySSF1036122.06E-3679155IPR004333Transcription factor, SBP-box
PfamPF031105.5E-3180153IPR004333Transcription factor, SBP-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0010321Biological Processregulation of vegetative phase change
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 204 aa     Download sequence    Send to blast
MEEGGEGKQK KMMVVKKESG DDSDSTDEYG QQHQGMGYFF DDDDDDSSES CKKKKLVIGN  60
SITASFAGGE RRVSGGGRCC QAEKCTNDLT VAKAYHRRHR VCEYHSKAQV VLVSGLRQRF  120
CQQCSRFHEL PEFDDMKRSC RRRLAGHNER RRKNAAADSH PHNHPHEGSS AMKEDTICGQ  180
VDPRGRIKIV TAENPSYKHF QIR*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ul4_A6e-3574153584squamosa promoter binding protein-like 4
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtProbable transcriptional factor. Binds to the promoter of the SQUAMOSA gene.
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00634PBMTransfer from PK22320.1Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMapLus10039846
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_021681200.18e-66squamosa promoter-binding protein 1-like isoform X1
SwissprotQ387414e-38SBP1_ANTMA; Squamosa promoter-binding protein 1
TrEMBLA0A2C9US053e-58A0A2C9US05_MANES; Uncharacterized protein
TrEMBLA0A2P5DNH32e-58A0A2P5DNH3_TREOI; SBP-box transcription factor
TrEMBLB9RVW33e-58B9RVW3_RICCO; Squamosa promoter-binding protein, putative
STRINGLus100398461e-150(Linum usitatissimum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF53534153
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G53160.24e-39squamosa promoter binding protein-like 4
Publications ? help Back to Top
  1. Klein J,Saedler H,Huijser P
    A new family of DNA binding proteins includes putative transcriptional regulators of the Antirrhinum majus floral meristem identity gene SQUAMOSA.
    Mol. Gen. Genet., 1996. 250(1): p. 7-16
    [PMID:8569690]