PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Lus10039284
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Linaceae; Linum
Family MYB_related
Protein Properties Length: 391aa    MW: 42823.4 Da    PI: 8.6907
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Lus10039284genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding38.13.7e-12161205147
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                      r +WT+ E++++++a +++  + Wk+I + +g  +t  q++s+ qky
      Lus10039284 161 RESWTEPEHDKFLEALQLFDRD-WKKIEAFIG-SKTVIQIRSHAQKY 205
                      789*****************77.*********.*************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466897.48E-16155211IPR009057Homeodomain-like
PROSITE profilePS5129413.758156210IPR017930Myb domain
TIGRFAMsTIGR015573.1E-18159208IPR006447Myb domain, plants
Gene3DG3DSA:1.10.10.605.9E-6159211IPR009057Homeodomain-like
SMARTSM007179.6E-10160208IPR001005SANT/Myb domain
PfamPF002498.2E-10161205IPR001005SANT/Myb domain
CDDcd001671.99E-7163206No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009651Biological Processresponse to salt stress
GO:0009723Biological Processresponse to ethylene
GO:0009737Biological Processresponse to abscisic acid
GO:0009739Biological Processresponse to gibberellin
GO:0009751Biological Processresponse to salicylic acid
GO:0009753Biological Processresponse to jasmonic acid
GO:0046686Biological Processresponse to cadmium ion
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 391 aa     Download sequence    Send to blast
MSDNAREPSD NIVTIINIFG IGAANPPMSS SGLCFRNEQA TDTSHALIRQ PKTLTTEPDR  60
MGFLSPDADS YKSTNPRCLM RNLHFSVCSL KSEASSNTQR TKMVSKNPNP VEGFYLDPDE  120
VALPGLGPFA ASSPAASNAT SSSFEDPSKK VRKPYTITKS RESWTEPEHD KFLEALQLFD  180
RDWKKIEAFI GSKTVIQIRS HAQKYFLKVQ KSGTGEHLPP PRPKRKAAHP YPQKASKNVL  240
PQSSGSIQSS VAPLEPNAPP DSPSMPLNPI TNVAAVPSKN NVPAVGPSLS NNCCSSSEST  300
PRTKQIGEVP EHAKPLRVLP DFAQVYTFIG SVFDPNVTGH LQKLKKMDPI DVETVFLLMR  360
NLSINLTSPD FEDHRRLLAS YEIEADASRQ *
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor. {ECO:0000250}.
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00560DAPTransfer from AT5G52660Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMapLus10039284
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankHQ8884351e-58HQ888435.1 Linum usitatissimum clone GMU2AYZ01BLVR4 microsatellite sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002513646.11e-152protein REVEILLE 6
SwissprotQ8H0W31e-118RVE6_ARATH; Protein REVEILLE 6
TrEMBLB9RIS71e-151B9RIS7_RICCO; DNA binding protein, putative
STRINGLus100392840.0(Linum usitatissimum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF11193396
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G52660.21e-102MYB_related family protein
Publications ? help Back to Top
  1. Ding Y, et al.
    Four distinct types of dehydration stress memory genes in Arabidopsis thaliana.
    BMC Plant Biol., 2013. 13: p. 229
    [PMID:24377444]
  2. Gray JA,Shalit-Kaneh A,Chu DN,Hsu PY,Harmer SL
    The REVEILLE Clock Genes Inhibit Growth of Juvenile and Adult Plants by Control of Cell Size.
    Plant Physiol., 2017. 173(4): p. 2308-2322
    [PMID:28254761]