PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Lus10038332
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Linaceae; Linum
Family NAC
Protein Properties Length: 279aa    MW: 32087.3 Da    PI: 7.7989
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Lus10038332genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM150.77e-47351622128
          NAM   2 ppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLp.kkvkaeekewyfFskrdkkyatgkrknr.atksgyWkatgkdkevlskkg 97 
                   pGfrFhPtdeelv +yL++kve+k l++ ++ik +d+yk++Pw+Lp     ++e+e+y+F++r +ky+++ r+nr ++  g+Wkatg dk+++s ++
  Lus10038332  35 LPGFRFHPTDEELVGFYLRRKVEKKALKI-DIIKLCDVYKYQPWELPrDGGGGGEREMYYFCRRGRKYKNSVRPNRvTAGCGFWKATGIDKSIYSGGE 131
                  59***************************.99***************445556888********************55559**************999 PP

          NAM  98 elvglkktLvfykgrapkgektdWvmheyrl 128
                   +vglkk+Lv+y+g+a kg+ktdW+mhe+rl
  Lus10038332 132 CVVGLKKSLVYYRGSAGKGTKTDWMMHEFRL 162
                  99***************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5100549.95234181IPR003441NAC domain
SuperFamilySSF1019411.44E-5035181IPR003441NAC domain
PfamPF023655.8E-2436162IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 279 aa     Download sequence    Send to blast
MEEEKLKLMI MTTKRRNAAV SCFVEEDKDD DVASLPGFRF HPTDEELVGF YLRRKVEKKA  60
LKIDIIKLCD VYKYQPWELP RDGGGGGERE MYYFCRRGRK YKNSVRPNRV TAGCGFWKAT  120
GIDKSIYSGG ECVVGLKKSL VYYRGSAGKG TKTDWMMHEF RLPPNDGYEA EVWTLCRIFK  180
REASCRKYAT TVQQRQAVSD RKRSSPVENH GYYSSNDMVS SGQLMAMNYF DHGSSTSAGD  240
QQQEAEEISL EEGEWDELRP MVDFALLDHH HRHSIFFT*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ut4_A5e-44251878171NO APICAL MERISTEM PROTEIN
1ut4_B5e-44251878171NO APICAL MERISTEM PROTEIN
1ut7_A5e-44251878171NO APICAL MERISTEM PROTEIN
1ut7_B5e-44251878171NO APICAL MERISTEM PROTEIN
3swm_A5e-442518711174NAC domain-containing protein 19
3swm_B5e-442518711174NAC domain-containing protein 19
3swm_C5e-442518711174NAC domain-containing protein 19
3swm_D5e-442518711174NAC domain-containing protein 19
3swp_A5e-442518711174NAC domain-containing protein 19
3swp_B5e-442518711174NAC domain-containing protein 19
3swp_C5e-442518711174NAC domain-containing protein 19
3swp_D5e-442518711174NAC domain-containing protein 19
4dul_A5e-44251878171NAC domain-containing protein 19
4dul_B5e-44251878171NAC domain-containing protein 19
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtTranscription factor that binds to the 5'- RRYGCCGT-3' consensus core sequence. Central longevity regulator. Negative regulator of leaf senescence. Modulates cellular H(2)O(2) levels and enhances tolerance to various abiotic stresses through the regulation of DREB2A. {ECO:0000269|PubMed:22345491}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapLus10038332
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: Up-regulated by H(2)O(2), paraquat, ozone, 3-aminotriazole and salt stress. {ECO:0000269|PubMed:22345491}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_021667022.13e-90transcription factor JUNGBRUNNEN 1-like
SwissprotQ9SK554e-74NAC42_ARATH; Transcription factor JUNGBRUNNEN 1
TrEMBLA0A1U7VGT12e-85A0A1U7VGT1_NICSY; transcription factor JUNGBRUNNEN 1-like
STRINGLus100383320.0(Linum usitatissimum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF101334112
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G43000.11e-76NAC domain containing protein 42
Publications ? help Back to Top
  1. Shahnejat-Bushehri S,Nobmann B,Devi Allu A,Balazadeh S
    JUB1 suppresses Pseudomonas syringae-induced defense responses through accumulation of DELLA proteins.
    Plant Signal Behav, 2016. 11(6): p. e1181245
    [PMID:27159137]
  2. Shahnejat-Bushehri S,Tarkowska D,Sakuraba Y,Balazadeh S
    Arabidopsis NAC transcription factor JUB1 regulates GA/BR metabolism and signalling.
    Nat Plants, 2016. 2: p. 16013
    [PMID:27249348]
  3. Shahnejat-Bushehri S, et al.
    Arabidopsis NAC Transcription Factor JUNGBRUNNEN1 Exerts Conserved Control Over Gibberellin and Brassinosteroid Metabolism and Signaling Genes in Tomato.
    Front Plant Sci, 2017. 8: p. 214
    [PMID:28326087]
  4. Sakuraba Y,Bülbül S,Piao W,Choi G,Paek NC
    Arabidopsis EARLY FLOWERING3 increases salt tolerance by suppressing salt stress response pathways.
    Plant J., 2017. 92(6): p. 1106-1120
    [PMID:29032592]
  5. Ebrahimian-Motlagh S, et al.
    JUNGBRUNNEN1 Confers Drought Tolerance Downstream of the HD-Zip I Transcription Factor AtHB13.
    Front Plant Sci, 2017. 8: p. 2118
    [PMID:29326734]