PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Lus10038043
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Linaceae; Linum
Family SBP
Protein Properties Length: 959aa    MW: 105292 Da    PI: 5.2881
Description SBP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Lus10038043genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SBP70.43.4e-22163210148
                  --SSTT-----TT--HHHHHTT--HHHHT-S-EEETTEEEEE-TTTSS CS
          SBP   1 lCqvegCeadlseakeyhrrhkvCevhskapvvlvsgleqrfCqqCsr 48 
                  +Cqve+C adls+ak+yhrrhkvCe+hska+++lv++++qrfCqqCsr
  Lus10038043 163 VCQVEDCGADLSKAKDYHRRHKVCEMHSKATKALVANVMQRFCQQCSR 210
                  6**********************************************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:4.10.1100.101.0E-22156210IPR004333Transcription factor, SBP-box
PROSITE profilePS5114117.136161238IPR004333Transcription factor, SBP-box
SuperFamilySSF1036121.96E-21162212IPR004333Transcription factor, SBP-box
PfamPF031108.1E-16164211IPR004333Transcription factor, SBP-box
CDDcd002044.85E-9714842No hitNo description
SuperFamilySSF484033.26E-8745842IPR020683Ankyrin repeat-containing domain
Gene3DG3DSA:1.25.40.203.8E-7746845IPR020683Ankyrin repeat-containing domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 959 aa     Download sequence    Send to blast
MEARFGTEAN HFYDMRAVGK RSMEWDLNDW KWDGDLFIAR PLNAVVPSSS AAASAGMSKQ  60
FFPLNNTNNN SSNSSSSCSD EVGNLEMIEK GKRRRNKVID VEEDDSLMVN GHQEEEAATL  120
SLKLGGHGGG EMVNWEGNSS GKKAKLTGGG GNNNNSSSSS RAVCQVEDCG ADLSKAKDYH  180
RRHKVCEMHS KATKALVANV MQRFCQQCSR RRKTNPEPGS NSNTVNDDQA GGYLLISLLR  240
TLSNMHSSKS EKSTDQDLLS HLLRSLAGQT IEHGGRNLAG LLEGPKELIN NGSLSGNPKQ  300
AQLVHANGAS LQTSSSMKSR MPNNFPSCSE VRDSNPRSLK MNNFDLNDAY IDSDDGTDDV  360
ERSPVPTNGG TSSLGCPSWA QQDSLQSSPP QMSGNSDSAS PQSPSSSNGD GQNRTDRIVF  420
KLFGKEPNDF PLVLRAQILD WLSHSPTDIE SYIRPGCIVL TIYLRQDEAG WDELCCDLST  480
SLSRLLHTSY DSFWRTGWLF VMMEHQIAFA YNGQVVVDTS SPLRNTDCGK ICSVKPIAVS  540
AAGKVQFLIK GTNLSRSSTR ILCAIEGKYM VQEDSDDLAH TEDIKDQGQL QCVPYSCSIP  600
TGLGRGFIEV EEDGISSSYF PFIVAEEDVC LEICTLENAL EFFETDLDGD LGEGGGKMEA  660
KNQAMEFIHE MGWLLHRIQS KSRLNDMDPN VDRFPISRMK WLMDFSMDHE WCAVVRTLLN  720
VVVRDGIVDL GGEYSSLNNA LAEMGVLHRA VRRNSRSLVE FLLKYAPEND DEFLFRPDMA  780
GPGGLTPLHI AAGKDGSEDI LDALTNDPKM VGVEAWKNSR DSTGFTPEDY ARLRGHYSYI  840
HLVQRKINRK LSEGSGHVVL DIPENEKQDE ALSSALEIMQ SALKKPSASS KSCKLCTGNK  900
VAYGVASSKR SLLYRPAMLS MVAVAAVCVC VALLFKSCPE VVYVLSPFRW EELEYGTS*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1wj0_A5e-23160210252squamosa promoter-binding protein-like 12
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1208213SRRRKT
Functional Description ? help Back to Top
Source Description
UniProtTrans-acting factor that binds specifically to the consensus nucleotide sequence 5'-TNCGTACAA-3' of AP1 promoter. Binds specifically to the 5'-GTAC-3' core sequence. {ECO:0000269|PubMed:10524240, ECO:0000269|PubMed:16095614}.
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00633PBMTransfer from PK06791.1Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMapLus10038043
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012082979.10.0squamosa promoter-binding-like protein 1
SwissprotQ9SMX90.0SPL1_ARATH; Squamosa promoter-binding-like protein 1
TrEMBLA0A067K9350.0A0A067K935_JATCU; Uncharacterized protein
STRINGLus100380430.0(Linum usitatissimum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF15393495
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G47070.10.0squamosa promoter binding protein-like 1
Publications ? help Back to Top
  1. Jorgensen SA,Preston JC
    Differential SPL gene expression patterns reveal candidate genes underlying flowering time and architectural differences in Mimulus and Arabidopsis.
    Mol. Phylogenet. Evol., 2014. 73: p. 129-39
    [PMID:24508602]
  2. Chao LM, et al.
    Arabidopsis Transcription Factors SPL1 and SPL12 Confer Plant Thermotolerance at Reproductive Stage.
    Mol Plant, 2017. 10(5): p. 735-748
    [PMID:28400323]