PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Lus10037200
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Linaceae; Linum
Family HD-ZIP
Protein Properties Length: 298aa    MW: 33689.2 Da    PI: 6.6557
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Lus10037200genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox57.22.8e-1880133356
                  --SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
     Homeobox   3 kRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56 
                  k+++++ eq+++Le+ Fe  +++  e++ +LA+ lgL+ rqV +WFqNrRa++k
  Lus10037200  80 KKRRLNMEQVKTLEKNFELGNKLEPERKMQLARALGLQPRQVAIWFQNRRARWK 133
                  456899***********************************************9 PP

2HD-ZIP_I/II132.41.7e-4279170192
  HD-ZIP_I/II   1 ekkrrlskeqvklLEesFeeeekLeperKvelareLglqprqvavWFqnrRARtktkqlEkdyeaLkraydalkeenerLekeveeLreelk 92 
                  ekkrrl+ eqvk+LE++Fe  +kLeperK++lar+Lglqprqva+WFqnrRAR+ktkqlEkdy+ Lkr+y+a+k++n++L++++++L++el 
  Lus10037200  79 EKKRRLNMEQVKTLEKNFELGNKLEPERKMQLARALGLQPRQVAIWFQNRRARWKTKQLEKDYDLLKRQYEAVKADNDSLQSQNQKLHAELV 170
                  69**************************************************************************************9986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466891.63E-1973137IPR009057Homeodomain-like
PROSITE profilePS5007117.02275135IPR001356Homeobox domain
SMARTSM003891.1E-1778139IPR001356Homeobox domain
PfamPF000461.2E-1580133IPR001356Homeobox domain
CDDcd000862.40E-1680136No hitNo description
Gene3DG3DSA:1.10.10.604.1E-1982142IPR009057Homeodomain-like
PRINTSPR000319.5E-6106115IPR000047Helix-turn-helix motif
PROSITE patternPS000270110133IPR017970Homeobox, conserved site
PRINTSPR000319.5E-6115131IPR000047Helix-turn-helix motif
PfamPF021831.5E-15135174IPR003106Leucine zipper, homeobox-associated
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 298 aa     Download sequence    Send to blast
MAFFQTNFML QSSHEDDHNH HQQPPASLNP ILPSCTPQDF HGVASFLGKR SMSCSGIDAC  60
HEEGNGEDEL SDDGSLAGEK KRRLNMEQVK TLEKNFELGN KLEPERKMQL ARALGLQPRQ  120
VAIWFQNRRA RWKTKQLEKD YDLLKRQYEA VKADNDSLQS QNQKLHAELV ALKSRGPAHE  180
SINLNKETEG SCSNRSESSS ENKLDTPPPA PAAIDSHPTS SGRPFFPTTS QLFHNNNNNN  240
SPSLRSPIGS DHHHHHQNPN IHKSIDQIVK EENLTTMFCS IDDQSGFWPW LEHQQFN*
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1127135RRARWKTKQ
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor that may act in the sucrose-signaling pathway. {ECO:0000269|PubMed:11292072}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapLus10037200
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_021614380.11e-150homeobox-leucine zipper protein ATHB-13-like
RefseqXP_021614381.11e-150homeobox-leucine zipper protein ATHB-13-like
RefseqXP_021614382.11e-150homeobox-leucine zipper protein ATHB-13-like
RefseqXP_021614383.11e-150homeobox-leucine zipper protein ATHB-13-like
SwissprotQ8LC031e-108ATB13_ARATH; Homeobox-leucine zipper protein ATHB-13
TrEMBLA0A251KUY61e-149A0A251KUY6_MANES; Uncharacterized protein
STRINGLus100372000.0(Linum usitatissimum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF127133106
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G69780.11e-101HD-ZIP family protein
Publications ? help Back to Top
  1. Ding Y, et al.
    Four distinct types of dehydration stress memory genes in Arabidopsis thaliana.
    BMC Plant Biol., 2013. 13: p. 229
    [PMID:24377444]
  2. Ribone PA,Capella M,Chan RL
    Functional characterization of the homeodomain leucine zipper I transcription factor AtHB13 reveals a crucial role in Arabidopsis development.
    J. Exp. Bot., 2015. 66(19): p. 5929-43
    [PMID:26136262]
  3. Wang X, et al.
    Overexpressed BRH1, a RING finger gene, alters rosette leaf shape in Arabidopsis thaliana.
    Sci China Life Sci, 2018. 61(1): p. 79-87
    [PMID:28887625]
  4. Ebrahimian-Motlagh S, et al.
    JUNGBRUNNEN1 Confers Drought Tolerance Downstream of the HD-Zip I Transcription Factor AtHB13.
    Front Plant Sci, 2017. 8: p. 2118
    [PMID:29326734]