PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Lus10037156
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Linaceae; Linum
Family NAC
Protein Properties Length: 297aa    MW: 33948.5 Da    PI: 8.8658
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Lus10037156genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM1752.2e-54131381128
          NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdkevlskkge 98 
                  lppGfrFhPtdeel+v+yLk+++++k++++ ++i+evdiyk++Pw+Lp+k++ +ekewyfFs+rd+ky++g r+nrat sgyWkatg+dk+++s  ++
  Lus10037156  13 LPPGFRFHPTDEELIVYYLKNQATSKPCPV-SIIPEVDIYKFDPWQLPEKAEFGEKEWYFFSPRDRKYPNGVRPNRATVSGYWKATGTDKAIYS-ASK 108
                  79****************************.89***************99999*****************************************.999 PP

          NAM  99 lvglkktLvfykgrapkgektdWvmheyrl 128
                   vg+kk Lvfy g+ pkg ktdW+mheyrl
  Lus10037156 109 CVGVKKALVFYIGKPPKGAKTDWIMHEYRL 138
                  9***************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019411.44E-6511165IPR003441NAC domain
PROSITE profilePS5100560.70113165IPR003441NAC domain
PfamPF023652.1E-2714138IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009825Biological Processmultidimensional cell growth
GO:0009835Biological Processfruit ripening
GO:0009908Biological Processflower development
GO:0010150Biological Processleaf senescence
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 297 aa     Download sequence    Send to blast
MIAAEKGSGC DQLPPGFRFH PTDEELIVYY LKNQATSKPC PVSIIPEVDI YKFDPWQLPE  60
KAEFGEKEWY FFSPRDRKYP NGVRPNRATV SGYWKATGTD KAIYSASKCV GVKKALVFYI  120
GKPPKGAKTD WIMHEYRLSD SRKQIIKHNG TMRLDDWVLC RIYKKKPSVG KQYLDQEINA  180
VAAASDYSQS TGRRIAEQVV VEEDTKEHQK MLKLPKTCSL SNLLELECLG PISQLLNDNS  240
NMITNGSFVG FQNTVVNQQN QYYYNTSTDS GKFQGMMNHH QLQQQQPFYV NQNQFQ*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ut4_A2e-731317117171NO APICAL MERISTEM PROTEIN
1ut4_B2e-731317117171NO APICAL MERISTEM PROTEIN
1ut7_A2e-731317117171NO APICAL MERISTEM PROTEIN
1ut7_B2e-731317117171NO APICAL MERISTEM PROTEIN
4dul_A2e-731317117171NAC domain-containing protein 19
4dul_B2e-731317117171NAC domain-containing protein 19
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtTranscription factor that binds DNA motifs 5'-CGT[AG](5N)NACG[ACT][AC][AT][ACG][ACT]-3' and 5'-CACG[ACT][AC][AT][AGT][CT]-3' in target genes promoters. Promotes leaf senescence (developmental, light-induced and ABA-induced senescence) and regulates fruit yield and sugar content, probably by establishing abscisic acid (ABA) homeostasis. Activates the expression of senescence and ABA associated genes including NCED1, ABCG40, CYP707A2, SAG113, SGR1 and PAO, by directly binding to their promoters. {ECO:0000269|PubMed:29760199}.
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00221DAPTransfer from AT1G69490Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMapLus10037156
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: Accumulates during age-dependent and dark-induced leaf senescence. Induced by abscisic acid (ABA). {ECO:0000269|PubMed:29760199}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012067682.11e-123NAC transcription factor 29
SwissprotK4BNG71e-114NAP2_SOLLC; NAC domain-containing protein 2
TrEMBLR4N7L51e-122R4N7L5_JATCU; NAC transcription factor 027
STRINGLus100371560.0(Linum usitatissimum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF41033262
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G69490.11e-102NAC-like, activated by AP3/PI
Publications ? help Back to Top
  1. Tomato Genome Consortium
    The tomato genome sequence provides insights into fleshy fruit evolution.
    Nature, 2012. 485(7400): p. 635-41
    [PMID:22660326]
  2. Ma X, et al.
    The NAC Transcription Factor SlNAP2 Regulates Leaf Senescence and Fruit Yield in Tomato.
    Plant Physiol., 2018. 177(3): p. 1286-1302
    [PMID:29760199]