PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Lus10036812
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Linaceae; Linum
Family SBP
Protein Properties Length: 439aa    MW: 49407 Da    PI: 7.1038
Description SBP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Lus10036812genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SBP134.73e-42134209277
                  -SSTT-----TT--HHHHHTT--HHHHT-S-EEETTEEEEE-TTTSSEEETTT--SS--S-STTTT-------S-- CS
          SBP   2 CqvegCeadlseakeyhrrhkvCevhskapvvlvsgleqrfCqqCsrfhelsefDeekrsCrrrLakhnerrrkkq 77 
                  Cqv gC++dls +k+yh+rh+vCevh+k+p+v+v+g++qrfCqqCsrfh lsefD++krsCr+rLa+hnerrrk++
  Lus10036812 134 CQVYGCNKDLSLLKDYHQRHRVCEVHTKTPTVVVNGIQQRFCQQCSRFHLLSEFDDGKRSCRKRLAGHNERRRKPN 209
                  **************************************************************************85 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:4.10.1100.101.3E-33131195IPR004333Transcription factor, SBP-box
PROSITE profilePS5114132.718131208IPR004333Transcription factor, SBP-box
SuperFamilySSF1036127.46E-40132211IPR004333Transcription factor, SBP-box
PfamPF031106.7E-33134207IPR004333Transcription factor, SBP-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 439 aa     Download sequence    Send to blast
MEPWSCAPEG KASFFTNHEV DFPADIDSLE FVDLGFHDDM LRSPCFGNGG GSSDEIGGFD  60
SHNFAAPNSP LDSGSIEHSS SLAESNIPDS SLIINLNLGR FSENGGEFCQ KRSLLDFVEP  120
GFQAKRARIV TPLCQVYGCN KDLSLLKDYH QRHRVCEVHT KTPTVVVNGI QQRFCQQCSR  180
FHLLSEFDDG KRSCRKRLAG HNERRRKPNF GGLSSNGYKL LQQYQAEGAS FVGAPLPKRS  240
SFLFQDMFTV PHCNLRTETN WYGHSSFKER SCCNTETAYP YNDQWLSTNP FSYHHGDGSN  300
RHSSRALSLL SDESQHYIGH GSVGGYPMAK PFPSLGSFGK CEFCSCTTNP IHVVNHHLEH  360
DPAEFHRKRH GHFPPHSIPD PDLKKNHHGS PENERTVDLL QLSSHLQRVE QQRSLVQMKN  420
ETEDLFHFLT TEGLRVKK*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ul4_A1e-281332071084squamosa promoter binding protein-like 4
Search in ModeBase
Cis-element ? help Back to Top
SourceLink
PlantRegMapLus10036812
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_021667340.12e-97squamosa promoter-binding-like protein 6
RefseqXP_021667341.12e-97squamosa promoter-binding-like protein 6
TrEMBLA0A2C9WH274e-95A0A2C9WH27_MANES; Uncharacterized protein
STRINGLus100368120.0(Linum usitatissimum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF18193493
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G69170.11e-55SBP family protein