PlantTFDB
Plant Transcription Factor Database
v5.0
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Lus10036665
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Linaceae; Linum
Family LBD
Protein Properties Length: 307aa    MW: 34267.1 Da    PI: 5.7819
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Lus10036665genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF260124.64.8e-39101101101
       DUF260   1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqqleqlkaelallk 98 
                  aCaaCk++rrkC+++C lapyfpa++p++f+n+hklFG++n++k+l++l++++r++am+s++++A++r   Pv+G++  i +lq +++q++++l++++
  Lus10036665  10 ACAACKYQRRKCTSECQLAPYFPANRPETFRNAHKLFGVRNIVKILEKLDHHQRQEAMQSIIWQANIRDIYPVRGCLDYIYALQYKIHQAQEDLHAVH 107
                  7************************************************************************************************9 PP

       DUF260  99 eel 101
                  ++l
  Lus10036665 108 SQL 110
                  985 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089124.9639110IPR004883Lateral organ boundaries, LOB
PfamPF031956.5E-3710107IPR004883Lateral organ boundaries, LOB
Sequence ? help Back to Top
Protein Sequence    Length: 307 aa     Download sequence    Send to blast
MTLKGGTSHA CAACKYQRRK CTSECQLAPY FPANRPETFR NAHKLFGVRN IVKILEKLDH  60
HQRQEAMQSI IWQANIRDIY PVRGCLDYIY ALQYKIHQAQ EDLHAVHSQL QIYRHQHPFP  120
DEDMVPLPSF QLQLGMAPPA AATTNALSLF GENPQPYVAG GPPEQVVALQ SPDLQHSYCM  180
SSNNNVVGGG GGGYSSGYLD NKDNAVGNSF WLHHNYGINN DEVINSSNMG LQPHPLGIQQ  240
ELVHDYDEMH PFFDTIDDRQ SYIDSTKEAY DTSSEESIKD TTQSLEHVVE NELKSAAACF  300
SLTSVN*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5ly0_A1e-2861137114LOB family transfactor Ramosa2.1
5ly0_B1e-2861137114LOB family transfactor Ramosa2.1
Search in ModeBase
Cis-element ? help Back to Top
SourceLink
PlantRegMapLus10036665
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002511502.11e-112LOB domain-containing protein 27
TrEMBLB9R9271e-111B9R927_RICCO; LOB domain-containing protein, putative
STRINGLus100366650.0(Linum usitatissimum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF44152958
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G47870.14e-53LOB domain-containing protein 27