PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Lus10036567
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Linaceae; Linum
Family HD-ZIP
Protein Properties Length: 790aa    MW: 85756.4 Da    PI: 6.2499
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Lus10036567genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox66.24.4e-21125180156
                  TT--SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
     Homeobox   1 rrkRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56 
                  +++ +++t++q++eLe+lF+++++p++++r eL+k+l L++rqVk+WFqNrR+++k
  Lus10036567 125 KKRYHRHTPQQIQELEALFKECPHPDEKQRLELSKRLCLETRQVKFWFQNRRTQMK 180
                  688999***********************************************999 PP

2START163.71.4e-513315461206
                  HHHHHHHHHHHHHHHHC-TT-EEEE....EXCCTTEEEEEEESSS......SCEEEEEEEECCSCHHHHHHHHHCCCGGCT-TT-S....EEEEEEEE CS
        START   1 elaeeaaqelvkkalaeepgWvkss....esengdevlqkfeeskv.....dsgealrasgvvdmvlallveellddkeqWdetla....kaetlevi 85 
                  ela++a++elvkka+ +ep+W ks     e++n +e+l++f++  +     + +ea+r++g+v+ ++  lve+l+d++ +W e+++    + +t++vi
  Lus10036567 331 ELALAAMDELVKKAQTDEPLWLKSLdggrEMLNHEEYLRTFTPCIGlkpngFVTEASRETGMVIINSLALVETLMDSN-RWAEMFPcmiaRTSTTDVI 427
                  5899**************************************99999***9***************************.******************* PP

                  CTT......EEEEEEEEXXTTXX-SSX.EEEEEEEEEEE.TTS-EEEEEEEEE-TTS--..-TTSEE-EESSEEEEEEEECTCEEEEEEEE-EE--SS CS
        START  86 ssg......galqlmvaelqalsplvp.RdfvfvRyirqlgagdwvivdvSvdseqkppe.sssvvRaellpSgiliepksnghskvtwvehvdlkgr 175
                  s+g      g lqlm aelq+lsplvp R++ f+R+             vSvd  ++++   + +  +++lpSg+++++++ng+skvtwveh +++++
  Lus10036567 428 SNGmggtrnGSLQLMHAELQVLSPLVPvREVNFLRFFVD----------VSVDAIREVSGgPPIFLSCRRLPSGCVVQDMPNGYSKVTWVEHGEYEES 515
                  ***********************************9766..........66666666665557899******************************** PP

                  XXHHHHHHHHHHHHHHHHHHHHHHTXXXXXX CS
        START 176 lphwllrslvksglaegaktwvatlqrqcek 206
                  ++h+l+r l++sg+ +ga++wvatlqrqce+
  Lus10036567 516 QIHQLYRLLIQSGMGFGAQRWVATLQRQCEC 546
                  *****************************96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466891.63E-20110182IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.601.6E-21112182IPR009057Homeodomain-like
PROSITE profilePS5007117.216122182IPR001356Homeobox domain
SMARTSM003899.9E-18123186IPR001356Homeobox domain
CDDcd000861.23E-18124182No hitNo description
PfamPF000461.3E-18125180IPR001356Homeobox domain
PROSITE patternPS000270157180IPR017970Homeobox, conserved site
PROSITE profilePS5084832.322322549IPR002913START domain
SuperFamilySSF559611.26E-23325546No hitNo description
CDDcd088751.24E-112326545No hitNo description
PfamPF018525.2E-44331546IPR002913START domain
SMARTSM002344.6E-34331546IPR002913START domain
SuperFamilySSF559615.49E-10568775No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009827Biological Processplant-type cell wall modification
GO:0042335Biological Processcuticle development
GO:0043481Biological Processanthocyanin accumulation in tissues in response to UV light
GO:0048765Biological Processroot hair cell differentiation
GO:0008289Molecular Functionlipid binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 790 aa     Download sequence    Send to blast
MSFGFLENGS PGGGRFVADY TTATTMSTTG GGMGSPPLLT PNFLSPNSFS KSMFSSPGLS  60
LALVRPQPNM DGVRQGDFGR ISENYETSVG RIRSREEEHD SRSGSDNLDG ASGDEQDAAD  120
KPPRKKRYHR HTPQQIQELE ALFKECPHPD EKQRLELSKR LCLETRQVKF WFQNRRTQMK  180
TQLERHENTL LRQENDKLRA ENMSIRDAMR NPMCSNCGGP AIIGDISLEE QHLRIENARL  240
KDELDRVCGL AGKFLGRPIS SLNNSLPPPM PNSSLELGVG NNDFGGFSTV AATLPVGPSD  300
HFGTPTANGL SIVTQNRPAS AGSLERSMLL ELALAAMDEL VKKAQTDEPL WLKSLDGGRE  360
MLNHEEYLRT FTPCIGLKPN GFVTEASRET GMVIINSLAL VETLMDSNRW AEMFPCMIAR  420
TSTTDVISNG MGGTRNGSLQ LMHAELQVLS PLVPVREVNF LRFFVDVSVD AIREVSGGPP  480
IFLSCRRLPS GCVVQDMPNG YSKVTWVEHG EYEESQIHQL YRLLIQSGMG FGAQRWVATL  540
QRQCECLAIL MSSTVPARDH TAAITASGRR SMLKLAQRMT DNFCAGVCAS TVHKWNKLNG  600
GNVEEDVRVM TRKSVDDPGE PPGIVLSAAT SVWLPVSPQF GCRCHPSGCL TFLGTKSMNA  660
NQSSMLILQE TCVDAAGSLV VYAPVDIPAM HVVMNGGDSA YVALLPSGFA IVPDGPGRRS  720
LGSTEDDAND NNGGGQTRAA ASGSLLTVAF QILVNSLPTA KLTVESVETV NNLISCTVQK  780
IKAALQCES*
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor involved in the regulation of the tissue-specific accumulation of anthocyanins and in cellular organization of the primary root. {ECO:0000269|PubMed:10402424}.
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00421DAPTransfer from AT4G00730Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMapLus10036567
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002320755.10.0homeobox-leucine zipper protein ANTHOCYANINLESS 2
SwissprotQ0WV120.0ANL2_ARATH; Homeobox-leucine zipper protein ANTHOCYANINLESS 2
TrEMBLB9IC550.0B9IC55_POPTR; Uncharacterized protein
STRINGLus100365670.0(Linum usitatissimum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF119234106
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G00730.10.0HD-ZIP family protein
Publications ? help Back to Top
  1. Duarte JM, et al.
    Expression pattern shifts following duplication indicative of subfunctionalization and neofunctionalization in regulatory genes of Arabidopsis.
    Mol. Biol. Evol., 2006. 23(2): p. 469-78
    [PMID:16280546]