PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Lus10035008
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Linaceae; Linum
Family Nin-like
Protein Properties Length: 297aa    MW: 33385.6 Da    PI: 8.3142
Description Nin-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Lus10035008genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1RWP-RK83.61.9e-26164214252
       RWP-RK   2 ekeisledlskyFslpikdAAkeLgvclTvLKriCRqyGIkRWPhRkiksl 52 
                   ++++ e++++yF++pi++AAke++v+lT+LK++CR+ G+kRWPhRk+ksl
  Lus10035008 164 ANHLTKEVVARYFHMPITQAAKEMNVGLTLLKKRCREIGVKRWPHRKLKSL 214
                  5789*********************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF126091.4E-171185IPR022251Protein of unknown function wound-induced
PROSITE profilePS5151918.405150234IPR003035RWP-RK domain
PfamPF020421.3E-21166214IPR003035RWP-RK domain
Sequence ? help Back to Top
Protein Sequence    Length: 297 aa     Download sequence    Send to blast
MSSTSRAWTA AVVVGAVEAL RDQGFCRWNH AIRSIHQISE NKIRSSSVSR QAKQAGQIRR  60
IVEEEQSGNR AEESLKTVID ITSYGEDGNQ LLFQEPNGYC YYGDNSVFQS TYGLISFDDA  120
ADPEVDASIW NELEPLLPSR ENRPVDVEEM KAAAAATTDV SSAANHLTKE VVARYFHMPI  180
TQAAKEMNVG LTLLKKRCRE IGVKRWPHRK LKSLRNLIAN VKQLAAEVEE EEGGSEDGGR  240
AKLEEAIREL ENERKVLDES PDLRLGPRTM RLRQACFKAT YKRKRKMNRL LHPSSN*
Cis-element ? help Back to Top
SourceLink
PlantRegMapLus10035008
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
STRINGLus100350080.0(Linum usitatissimum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF61843052
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G66990.19e-41RWP-RK domain-containing protein