PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Lus10034456
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Linaceae; Linum
Family Nin-like
Protein Properties Length: 356aa    MW: 40109.6 Da    PI: 5.0613
Description Nin-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Lus10034456genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1RWP-RK81.11.2e-25164213352
       RWP-RK   3 keisledlskyFslpikdAAkeLgvclTvLKriCRqyGIkRWPhRkiksl 52 
                  + i+ e+ls+yF++pi++AAke++v+lT+LK++CR++G++RWPhRk+ sl
  Lus10034456 164 QVITREMLSRYFYMPITEAAKEMNVGLTLLKKRCRELGVRRWPHRKLMSL 213
                  6799*******************************************997 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5151917.359147233IPR003035RWP-RK domain
PfamPF020424.0E-21166213IPR003035RWP-RK domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0051302Biological Processregulation of cell division
Sequence ? help Back to Top
Protein Sequence    Length: 356 aa     Download sequence    Send to blast
MEFVEVKQEQ DHFQIRSSPP LLHDDSQQQA PFGGLFDDFT FGSHGGGDDD YYSSSSLPPF  60
PLFNHQFELE APFTQLDQYY QDPDIVNAAD GDRYGTDIMN MMISSTNILH HSSSSSISSS  120
SCSSHIDHDP VCNELGPPLL PILDHEQKTT TNEHNKAVSP NGQQVITREM LSRYFYMPIT  180
EAAKEMNVGL TLLKKRCREL GVRRWPHRKL MSLNTLISNV RHLLNNQEQG EGGHDEGEGG  240
LTRLGKLEEA VRVLEHERKV LEECPDLQLE SNTKRLRQAC FKANYKRKRK HGLTMMIDHD  300
DASCGRGRPR NVSRSDVVVQ DTTTAAVATN LGYEDDDGDE EIRSLLLPAE FDFAF*
Cis-element ? help Back to Top
SourceLink
PlantRegMapLus10034456
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankHQ8876101e-100HQ887610.1 Linum usitatissimum clone GMU2AYZ01A0ZA0 microsatellite sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_024976367.15e-49uncharacterized protein LOC112514264
TrEMBLA0A2R6QH618e-52A0A2R6QH61_ACTCH; Uncharacterized protein
STRINGLus100344560.0(Linum usitatissimum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF61843052
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G18790.12e-43RWP-RK domain-containing protein