PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Lus10034370
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Linaceae; Linum
Family MIKC_MADS
Protein Properties Length: 230aa    MW: 26806.6 Da    PI: 9.753
Description MIKC_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Lus10034370genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF88.34.2e-281059251
                 ---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE- CS
       SRF-TF  2 rienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeyss 51
                 rienk+ rqvtfskRr g+lKKA+E+SvLCda+ a+i+fs++gkl+eyss
  Lus10034370 10 RIENKISRQVTFSKRRGGLLKKAHEISVLCDAQLALIVFSTKGKLFEYSS 59
                 8***********************************************96 PP

2K-box85.79.8e-29901801199
        K-box  11 eakaeslqqelakLkkeienLqreqRhllGedLesLslkeLqqLeqqLekslkkiRskKnellleqieelqkk..ekelqeenkaLrkkle 99 
                  ++  +s++ e  kL ++ie Lqr++R+l+Ge+++++sl+eLqqLeqq++++lkk+Rs+Kn+l++e+i++lqkk  e++l+e+n  L kk++
  Lus10034370  90 QQPGSSWTMECPKLMSRIEVLQRNLRNLVGEEIDPMSLRELQQLEQQIDTALKKVRSRKNQLYHESISNLQKKvqERSLNEQNGVLAKKVK 180
                  555679******************************************************************9445568999999999986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM004321.3E-37160IPR002100Transcription factor, MADS-box
PROSITE profilePS5006631.3161IPR002100Transcription factor, MADS-box
CDDcd002656.63E-41277No hitNo description
SuperFamilySSF554553.14E-31281IPR002100Transcription factor, MADS-box
PRINTSPR004041.7E-29323IPR002100Transcription factor, MADS-box
PROSITE patternPS003500357IPR002100Transcription factor, MADS-box
PfamPF003196.4E-241057IPR002100Transcription factor, MADS-box
PRINTSPR004041.7E-292338IPR002100Transcription factor, MADS-box
PRINTSPR004041.7E-293859IPR002100Transcription factor, MADS-box
PROSITE profilePS5129715.38293185IPR002487Transcription factor, K-box
PfamPF014861.2E-2493179IPR002487Transcription factor, K-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 230 aa     Download sequence    Send to blast
MGRGRVEMRR IENKISRQVT FSKRRGGLLK KAHEISVLCD AQLALIVFST KGKLFEYSSD  60
DSSMDMILER YERYSYAEKN HQLPITDPQQ QPGSSWTMEC PKLMSRIEVL QRNLRNLVGE  120
EIDPMSLREL QQLEQQIDTA LKKVRSRKNQ LYHESISNLQ KKVQERSLNE QNGVLAKKVK  180
KNEKEVATTE NEEQQQHQNN EMLQLPPMNI GWGKPHHRSL CHNKHDLFL*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
6byy_A3e-21175173MEF2 CHIMERA
6byy_B3e-21175173MEF2 CHIMERA
6byy_C3e-21175173MEF2 CHIMERA
6byy_D3e-21175173MEF2 CHIMERA
6bz1_A3e-21175173MEF2 CHIMERA
6bz1_B3e-21175173MEF2 CHIMERA
6bz1_C3e-21175173MEF2 CHIMERA
6bz1_D3e-21175173MEF2 CHIMERA
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor involved in flower development. {ECO:0000250|UniProtKB:Q0HA25}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapLus10034370
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010029407.17e-89PREDICTED: truncated transcription factor CAULIFLOWER A
SwissprotD7SMN61e-83FULL_VITVI; Agamous-like MADS-box protein FUL-L
TrEMBLA0A2H4L6L42e-88A0A2H4L6L4_CERJA; FUL-like protein
STRINGLus100343701e-170(Linum usitatissimum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF58832119
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G69120.12e-71MIKC_MADS family protein
Publications ? help Back to Top
  1. Jaillon O, et al.
    The grapevine genome sequence suggests ancestral hexaploidization in major angiosperm phyla.
    Nature, 2007. 449(7161): p. 463-7
    [PMID:17721507]
  2. Díaz-Riquelme J,Lijavetzky D,Martínez-Zapater JM,Carmona MJ
    Genome-wide analysis of MIKCC-type MADS box genes in grapevine.
    Plant Physiol., 2009. 149(1): p. 354-69
    [PMID:18997115]
  3. Grimplet J,Martínez-Zapater JM,Carmona MJ
    Structural and functional annotation of the MADS-box transcription factor family in grapevine.
    BMC Genomics, 2016. 17: p. 80
    [PMID:26818751]