PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Lus10033993
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Linaceae; Linum
Family SBP
Protein Properties Length: 796aa    MW: 88304.2 Da    PI: 6.8311
Description SBP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Lus10033993genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SBP115.33.3e-36135211177
                  --SSTT-----TT--HHHHHTT--HHHHT-S-EEETTEEEEE-TTTSSEEETTT--SS--S-STTTT-------S-- CS
          SBP   1 lCqvegCeadlseakeyhrrhkvCevhskapvvlvsgleqrfCqqCsrfhelsefDeekrsCrrrLakhnerrrkkq 77 
                  +Cqv+gCe+d++e+k yhrrh+vC  +++a++v ++g+++r+CqqC++fh l +fDe+krsCrr+L++hn+rrr+k+
  Lus10033993 135 RCQVPGCEVDITELKGYHRRHRVCLRCANATAVKIDGETKRYCQQCGKFHLLPDFDEGKRSCRRKLERHNNRRRRKS 211
                  6*************************************************************************986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:4.10.1100.102.2E-28130197IPR004333Transcription factor, SBP-box
PROSITE profilePS5114129.427133210IPR004333Transcription factor, SBP-box
SuperFamilySSF1036121.31E-33134213IPR004333Transcription factor, SBP-box
PfamPF031104.2E-27136210IPR004333Transcription factor, SBP-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 796 aa     Download sequence    Send to blast
MEPPSPPPSA LLDDRMESLH HNQLPSVTES YPPSSSSPGA WELTDLLDFN IDDDFPLPFD  60
SLDLPDDNPD SYFSPHDNPP TERVRKRDPR STCSNFLAGR VPCACPELDE KLEQEEGVPG  120
KKRARVARGG PGMYRCQVPG CEVDITELKG YHRRHRVCLR CANATAVKID GETKRYCQQC  180
GKFHLLPDFD EGKRSCRRKL ERHNNRRRRK SLNSNVSTNE GTIMDNLQAE DAACNGETEK  240
DGLSLQIVGK EALVVIEDGP GFQSESQKVN SDSGAASAET LFDAGNDDSG GKYDSKLSRS  300
PSNFDNGTAY SSLCPTGRVS FKLYDWNPAE FPRRLRHQIF QWLASMPVEL EAYVRPGCTN  360
LTVFAAMPTR MWAKLLKDPL SYVQKFVLVP GSMLSGKGRM IVYLDNLMFR VLKGGTSVMQ  420
LNVGTQSPRL HYVHPNCFEA GKPMEFVACG SNLFQSNFRL LVSFDGKYLA YDSCVGLPSG  480
GVDGNASRDH QLFKISIPHV DPNIFGPAFI EVENGSGLSN FIPVLVGDRQ ICSEMEVIQQ  540
RLEVLNNVRG FHCEISQTRQ RILSELIVDV AWLLKAPSQD RIRQTASSLQ IQRFVSLLQF  600
LIQHDSTFIL RKVLSNLMIT VGAISSENVI NGNTDAEAKL LKQYMDEASR FLHQKANRSN  660
GLALAPEHSS SGECDVDRCC PRTDFRLVAA LSDEDIENRT NNLLRLSEGS RPDVRSDEMP  720
LLNNGDVVMD VKLVKERPGK SCSVILSNKV PKSRAAMFVI ATVAVCVGVC AVLLHPNSVG  780
KMAVSIRSCW TESRY*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ul5_A4e-40135214584squamosa promoter binding protein-like 7
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1196208RRKLERHNNRRRR
Cis-element ? help Back to Top
SourceLink
PlantRegMapLus10033993
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_021635647.10.0squamosa promoter-binding-like protein 7 isoform X1
RefseqXP_021635648.10.0squamosa promoter-binding-like protein 7 isoform X2
RefseqXP_021635649.10.0squamosa promoter-binding-like protein 7 isoform X3
RefseqXP_021635650.10.0squamosa promoter-binding-like protein 7 isoform X4
TrEMBLA0A2C9WAE20.0A0A2C9WAE2_MANES; Uncharacterized protein
STRINGLus100339930.0(Linum usitatissimum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF64703450
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G18830.30.0squamosa promoter binding protein-like 7